Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '27851'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.23 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '27851' and pd.language_id = 1
Query
Database
1.87 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '27851'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
1.99 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '27851'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '27851' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '27851'
⇄⧉products_description => string (563) "Background: beta-1,3-glucanase (EC 3.2.1.73) mainly exists in plant, and it ...
$value['products_description']
Background: beta-1,3-glucanase (EC 3.2.1.73) mainly exists in plant, and it catalyzes the hydrolysis of beta-1,3-glucoside bond. Plant cells would induced to synthesize large amounts of beta-1,3- glucanase when they are infected or in extreme environments. Thus, beta-1,3- glucanase enzyme assays are widely applied in the research of plant pathology and adversity physiology. beta-1,3-glucanase could hydrolyse laminarin, and cut beta-1,3-glucoside bond to produce reducing terminus. So generating rates of reducing sugar could calculate the activity of enzymes.
⇄⧉products_description => string (563) "Background: beta-1,3-glucanase (EC 3.2.1.73) mainly exists in plant, and it ...
$value->a['products_description']
Background: beta-1,3-glucanase (EC 3.2.1.73) mainly exists in plant, and it catalyzes the hydrolysis of beta-1,3-glucoside bond. Plant cells would induced to synthesize large amounts of beta-1,3- glucanase when they are infected or in extreme environments. Thus, beta-1,3- glucanase enzyme assays are widely applied in the research of plant pathology and adversity physiology. beta-1,3-glucanase could hydrolyse laminarin, and cut beta-1,3-glucoside bond to produce reducing terminus. So generating rates of reducing sugar could calculate the activity of enzymes.
⇄⧉products_description => string (563) "Background: beta-1,3-glucanase (EC 3.2.1.73) mainly exists in plant, and it ...
$value->d['products_description']
Background: beta-1,3-glucanase (EC 3.2.1.73) mainly exists in plant, and it catalyzes the hydrolysis of beta-1,3-glucoside bond. Plant cells would induced to synthesize large amounts of beta-1,3- glucanase when they are infected or in extreme environments. Thus, beta-1,3- glucanase enzyme assays are widely applied in the research of plant pathology and adversity physiology. beta-1,3-glucanase could hydrolyse laminarin, and cut beta-1,3-glucoside bond to produce reducing terminus. So generating rates of reducing sugar could calculate the activity of enzymes.
⇄⧉products_description => string (685) "Background: Glutathione reductase (GR, EC 1.6.4.2) is a flavoprotein that ca...
$value[0]['_source']['products_description']
Background: Glutathione reductase (GR, EC 1.6.4.2) is a flavoprotein that catalyzes the NADPH-dependent reduction of oxidized glutathione (GSSG) to glutathione (GSH). This enzyme is essential for the GSH redox cycle which maintains adequate levels of reduced cellular GSH. A high GSH/GSSG ratio is essential for protection against oxidative stress. Glutathione Reductase Microplate Assay Kit measures GR activity by measuring the rate of NADPH oxidation. The oxidation of NADPH to NADP+ is accompanied by a decrease in absorbance at 340 nm. Since GR is present at rate limiting concentrations, the rate of decrease in the A340 is directly proportional to the GR activity in the sample.
⇄⧉ncbi_pathways => string (447) "Cellular Responses To Stress Pathway||1330688!!Detoxification Of Reactive Ox...
$value[0]['_source']['ncbi_pathways']
Cellular Responses To Stress Pathway||1330688!!Detoxification Of Reactive Oxygen Species Pathway||1330689!!Gene Expression Pathway||1330623!!Generic Transcription Pathway||1330624!!Glutathione Metabolism Pathway||4032!!Glutathione Metabolism Pathway||343!!Metabolism Pathway||1331013!!Metabolism Of Amino Acids And Derivatives Pathway||1331175!!Metabolism Of Ingested MeSeO2H Into MeSeH Pathway||1331203!!Metabolism Of Nucleotides Pathway||1331150
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[1]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Canine GSH monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[1]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[1]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[1]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[1]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[1]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[1]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[1]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[1]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[1]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[1]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[1]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[1]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[1]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[1]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[1]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[1]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[1]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[1]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[1]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[1]['_source']['products_viewed']
⇄⧉search_terms => string (338) "aaa22687 canine no cross reaction with other factors typical testing data st...
$value[1]['_source']['search_terms']
aaa22687 canine no cross reaction with other factors typical testing data standard curve for reference only aaa22687_sc elisa kit glutathione gsh samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 mmol l 1.56 sensitivity up to 0.5 intra precision <= 8 inter 12 range100 to0.5 <=8 inter12
<b>Introduction: </b>The Analyte<br>Glutathione (gamma-glutamylcysteinylglycine or GSH) is a naturally occuring tripeptide whose<br>nucleophilic and<br>reducing properties play a central role in metabolic pathways, as well as in the antioxidant system of most<br>aerobic<br>cells.1 GSH plays a critical role as a coenzyme with a variety of enzymes including, glutathione peroxidase,<br>glutathione S-transferase, and thiol transferase. GSH also plays major roles in drug metabolism, calcium<br>metabolism, the ?-glutamyl cycle, blood platelet, and membrane functions. In addition, GSH is crucial to a<br>variety of<br>life processes, including the detoxification of xenobiotics, maintenance of the -SH level of proteins, thiol-<br>disulfide<br>exchange, removal of hydroperoxides and free radicals, and amino acid transport across membranes.<br>Physiological<br>values of intracellular GSH generally range from 1 to 10 mM. Although many methods have been<br>described for the<br>assay of GSH, the reliable ones are labor intensive and not easy to use.2).<br>Principles of the Procedures<br>This method is based on a chemical reaction which proceeds in two steps. The first step leads to the<br>formation of<br>substitution products (thioethers) between a patented reagent, R1 (4-chloro-1-methyl-7-trifluromethyl-<br>quinolinium<br>methylsulfate), and all mercaptans (RSH) which are present in the sample:<br>The second step is a ?-elimination reaction which takes place under alkaline conditions. This reaction is<br>mediated by<br>reagent R2 (30% NaOH) which specifically transforms the substitution product (thioether) obtained with<br>GSH into a<br>chromophoric thione which has a maximal absorbance wavelength at 400 nm:<br>This method makes it possible to specifically assay glutathione with only one sampling and one<br>colorimetric<br>measurement. A modification of this method can be used to assay other mercaptans. This is based on the<br>measurement of substitution products, thioethers, which absorb light at 356 nm in the absence of reagent<br>R<br>2.<br>Because of its simplicity, this method is especially well adapted to the assay of glutathione in large series<br>of<br>biological samples. The main advantage of the method is the specificity for glutathione and it does not<br>require an<br>enzyme as a reagent.
⇄⧉products_references => string (399) "1. Dolphin D., Poulson R. and Avramovic O., Eds. (1989), Glutathione: Chemic...
$value[2]['_source']['products_references']
1. Dolphin D., Poulson R. and Avramovic O., Eds. (1989), Glutathione: Chemical, Biochemical and Medical<br>Aspects, Vols A & B, J. Wiley and Sons.<br>2. Anderson M.E. (1989), Enzymatic and chemical methods for the determination of Glutathione; In:<br>Glutathione:<br>chemical, biochemical and medical aspects, Vol. A, Dolphin D., Poulson R. and Avramovic O. Eds., John<br>Wiley and Sons, pp.339-365.
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of D...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of DHFR. No significant cross-reactivity or interference between DHFR and analogues was observed.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[3]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[3]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (260) "Neoplasms, Experimental||109!!Nervous System Diseases||56!!Lung Diseases||55...
⇄⧉search_terms => string (512) "aaa17449 human this assay has high sensitivity and excellent specificity for...
$value[3]['_source']['search_terms']
aaa17449 human this assay has high sensitivity and excellent specificity for detection of dhfr no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17449_sc elisa kit dihydrofolate reductase dhfrp1 dyr ec 1.5.1.3 dhfr1 21,638 da dyr_rat 18426814 np_569084.1 q920d2 nm_130400.2 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 78.125 5000pg ml 46.875pg intra precision cv<8 inter cv<10
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[4]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse GSH monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (542) "aaa12979 mouse typical testing data standard curve for reference only aaa129...
$value[4]['_source']['search_terms']
aaa12979 mouse typical testing data standard curve for reference only aaa12979_sc elisa kit glutathione gsh s transferase mu 2 isoform muscle gstm2 gst4 gstm gthmus gst class 4 m1 aryltransferase m2 alkyltransferase aralkyltransferase hydroxyalkyl lyase 22,644 da gstm2_human 215277000 np_001135840.1 p28161 nm_001142368.1 q2m318 q5tzy5 q8wwe1 b4dry4 e9pem9 138380 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 mmol l 1.56 sensitivity up to 0.5 intra precision mu2 class4 range100 to0.5
⇄⧉etc_term1 => string (131) "Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue hom...
$value[5]['_source']['etc_term1']
Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue homogenate!!Assay Type||Competitive!!Sensitivity||0.1ng/ml
⇄⧉etc_term2 => string (195) "Intended Uses||This GT ELISA kit is a 1.5 hour solid-phase ELISA designed fo...
$value[5]['_source']['etc_term2']
Intended Uses||This GT ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Porcine GT. This ELISA kit for research use only, not for therapeutic applications!
⇄⧉products_description => string (1155) "<b>Principle of the assay: </b>GT ELISA kit applies the competitive enzyme i...
$value[5]['_source']['products_description']
<b>Principle of the assay: </b>GT ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-GT antibody and an GT-HRP conjugate. The assay sample and buffer are incubated together with GT-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the GT concentration since GT from samples and GT-HRP conjugate compete for the anti-GT antibody binding site. Since the number of sites is limited, as more sites are occupied by GT from the sample, fewer sites are left to bind GT-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The GT concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (451) "aaa17155 porcine typical testing data standard curve for reference only aaa1...
$value[5]['_source']['search_terms']
aaa17155 porcine typical testing data standard curve for reference only aaa17155_td elisa kit glutathione gt jdm601_3579 17,237 da peroxidase f5z1c3_mycsd 333992219 yp_004524833.1 nc_015576.1 samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive sensitivity 0.1ng ml intended uses this is a 1.5 hour solid phase designed the quantitative determination of research use not therapeutic applications! a1.5
⇄⧉sequence => string (399) "<font color="red">Antigen: </font>The target protein is fused with two N-ter...
$value[6]['_source']['sequence']
<font color="red">Antigen: </font>The target protein is fused with two N-terminal Tags, His-tag and T7-tag and its sequence is listed below.<br>MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS- IRVYSMR FCPFAQRTLM VLKAKGIRHE VININLKNKP EWFFEKNPLG LVPVLENSQG HLVTESVITC EYLDEAYPEK KLFPDDPYKK ARQKMTLESF SKVPPLIASF VRSKRKEDSP NLREALENEF KKLEEGMDNY KSFLGGDSPS MVDYLTWPWF QRLEALELKE CLAHTPKLKL WMAAMQQDPV ASSHKIDAKT
⇄clonality => string (10) "Polyclonal"
$value[6]['_source']['clonality']
⇄isotype => string (3) "N/A"
$value[6]['_source']['isotype']
⇄clone_number => string (3) "N/A"
$value[6]['_source']['clone_number']
⇄host => string (6) "Rabbit"
$value[6]['_source']['host']
⇄reactivity => string (5) "Mouse"
$value[6]['_source']['reactivity']
⇄⧉specificity => string (174) "The antibody is a rabbit polyclonal antibody raised against GSTo1. It has be...
$value[6]['_source']['specificity']
The antibody is a rabbit polyclonal antibody raised against GSTo1. It has beenselected for its ability to recognize GSTo1 in immunohistochemical staining andwestern blotting.
⇄purity => string (23) "Affinity Chromatography"
$value[6]['_source']['purity']
⇄form => string (6) "Liquid"
$value[6]['_source']['form']
⇄concentration => string (8) "500ug/mL"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (189) "Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C...
$value[6]['_source']['storage_stability']
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Western blotting: 0.5-2ug/mL<br>Immunohistochemistry: 5-20ug/mL<br>Immunocytochemistry: 5-20ug/mL<br>Optimal working dilutions must be determined by end user.
aaa20899 rabbit mouse polyclonal affinity chromatography liquid the antibody is a raised against gsto1 it has beenselected for its ability to recognize in immunohistochemical staining andwestern blotting western blot wb immunocytochemistry icc immunohistochemistry ihc formalin paraffin elisa eia 0.5 2ug ml 5 20ug optimal working dilutions must be determined by end user sample lane1 liver tissue lane2 heart lane3 lung aaa20899_wb recombinant aaa20899_wb2 dab on p samples pancreas aaa20899_ihc stomach aaa20899_ihc2 aaa20899_ihc3 antigen target protein fused with two n terminal tags his tag and t7 sequence listed below mgsshhhhhh ssglvprgsh masmtggqqm grgs irvysmr fcpfaqrtlm vlkakgirhe vininlknkp ewffeknplg lvpvlensqg hlvtesvitc eyldeaypek klfpddpykk arqkmtlesf skvppliasf vrskrkedsp nlrealenef kkleegmdny ksflggdsps mvdyltwpwf qrlealelke clahtpklkl wmaamqqdpv asshkidakt glutathione s transferase omega 1 p28 gstx spg r gsto aa407097 ai194287 au018802 27,498 da dependent dehydroascorbate reductase ec:1.8.5.1 gtsttl mma v 6754090 np_034492.1 o09131 nm_010362.3 q3th87 fragment ile24~pro233 organism species mus musculus cross reactivity conjugate no immunogen expressed e coli conjugated apc version of this item also available as catalog #mbs2045131 eia0.5 ml5 omega1
⇄⧉products_description => string (823) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[7]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat GSH monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (539) "aaa12858 rat typical testing data standard curve for reference only aaa12858...
$value[7]['_source']['search_terms']
aaa12858 rat typical testing data standard curve for reference only aaa12858_sc elisa kit glutathione gsh s transferase mu 2 isoform muscle gstm2 gst4 gstm gthmus gst class 4 m1 aryltransferase m2 alkyltransferase aralkyltransferase hydroxyalkyl lyase 22,644 da gstm2_human 215277000 np_001135840.1 p28161 nm_001142368.1 q2m318 q5tzy5 q8wwe1 b4dry4 e9pem9 138380 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 ug ml 1.56 sensitivity up to 0.5 intra precision mu2 class4 range100 to0.5
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[8]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human GSH monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (579) "aaa12832 human no cross reaction with other factors typical testing data sta...
$value[8]['_source']['search_terms']
aaa12832 human no cross reaction with other factors typical testing data standard curve for reference only aaa12832_sc elisa kit glutathione gsh s transferase mu 2 isoform muscle gstm2 gst4 gstm gthmus gst class 4 m1 aryltransferase m2 alkyltransferase aralkyltransferase hydroxyalkyl lyase 22,644 da gstm2_human 215277000 np_001135840.1 p28161 nm_001142368.1 q2m318 q5tzy5 q8wwe1 b4dry4 e9pem9 138380 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 mmol l 1.56 sensitivity up to 0.5 intra precision mu2 class4 range100 to0.5
⇄⧉products_description => string (1477) "Background: Nitrate Reductase (NR), also known as respiratory nitrate reduct...
$value[9]['_source']['products_description']
Background: Nitrate Reductase (NR), also known as respiratory nitrate reductase. Eukaryotic nitrate reductases are part of the sulfite oxidase family of molybdoenzymes. They transfer electrons from NADH or NADPH to nitrate. Prokaryotic nitrate reductases belong to the DMSO reductase family of molybdoenzymes and have been classified into three groups, assimilatory nitrate reductases (Nas), respiratory nitrate reductase (Nar), and periplasmic nitrate reductases (Nap). The active site of these enzymes is a Mo ion that is bound to the four thiolate functions of two pterin molecules. The coordination sphere of the Mo is completed by one amino-acid side chain and oxygen and/or sulfur ligands. The exact environment of the Mo ion in certain of these enzymes (oxygen versus sulfur as a sixth molybdenum ligand) is still debated. The Mo is covalently attached to the protein by a cysteine ligand in Nap, and an aspartate in Nar. Nitrate reductase activity can be used as a biochemical tool for predicting grain yield and grain protein production. Nitrate reductase promotes amino acid production in tea leaves. It is reported that tea plants sprayed with various micronutrients (like Zn, Mn and B) along with Mo enhanced the amino acid content of tea shoots and also the crop yield. The assay is initiated with the enzymatic hydrolysis of the nitrate by Nitrate Reductase. The enzyme catalysed reaction products azo-compound can be measured at a colorimetric readout at 540 nm.
⇄⧉search_terms => string (273) "aaa17849 general functional assay typical testing data standard curve for re...
$value[9]['_source']['search_terms']
aaa17849 general functional assay typical testing data standard curve for reference only aaa17849_sc kit nitrate reductase marky_1807 106,991 da f2npn8_marht 328951314 yp_004368649.1 nc_015387.1 samples tissue extracts cell lysate detection range 0.1 umol ml 8 range0.1 ml8
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human GPX3. No significant cross-reactivity or interference between human GPX3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[10]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for GPX3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any GPX3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for GPX3 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GPX3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (539) "aaa15642 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa15642 human this assay has high sensitivity and excellent specificity for detection of gpx3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15642_td elisa kit glutathione peroxidase 3 gpx p gshpx extracellular plasma 25,552 da gpxp gpx3_human 6006001 np_002075.2 p22352 nm_002084.3 o43787 q86w78 q9nz74 q9uel1 138321 samples serum tissue homogenates type quantitative sandwich range 15.6 uiu ml 1000 < 3.9 intra precision within an cv peroxidase3 <3.9
⇄⧉products_description => string (1326) "Intended Uses: This OXB ELISA kit is a 1.5 hour solid-phase ELISA designed f...
$value[11]['_source']['products_description']
Intended Uses: This OXB ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat OXB. This ELISA kit for research use only!<br><br>Principle of the Assay: OXB ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-OXB antibody and an OXB-HRP conjugate. The assay sample and buffer are incubated together with OXB-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the OXB concentration since OXB from samples and OXB-HRP conjugate compete for the anti-OXB antibody binding site. Since the number of sites is limited, as more sites are occupied by OXB from the sample, fewer sites are left to bind OXB-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The OXB concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (271) "aaa17233 bovine typical testing data standard curve for reference only aaa17...
$value[11]['_source']['search_terms']
aaa17233 bovine typical testing data standard curve for reference only aaa17233_sc elisa kit oxidized glutathione gssg samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 1.0 pg ml sensitivity1.0
⇄⧉products_description => string (673) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[12]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is human AR monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
aldose reductase; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1
⇄ncbi_chrom_loc => string (3) "N/A"
$value[12]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "231"
$value[12]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "35,853 Da"
$value[12]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (415) "Fructose And Mannose Metabolism Pathway||82930!!Fructose And Mannose Metabol...
$value[12]['_source']['ncbi_pathways']
Fructose And Mannose Metabolism Pathway||82930!!Fructose And Mannose Metabolism Pathway||291!!Galactose Metabolism Pathway||82931!!Galactose Metabolism Pathway||292!!Glycerolipid Metabolism Pathway||82986!!Glycerolipid Metabolism Pathway||361!!Metabolic Pathways||132956!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!Metabolism Of Steroid Hormones And Vitamin D Pathway||106150
⇄⧉search_terms => string (524) "aaa22395 human no cross reaction with other factors typical testing data sta...
$value[12]['_source']['search_terms']
aaa22395 human no cross reaction with other factors typical testing data standard curve for reference only aaa22395_sc elisa kit aldose reductase ar aldo keto family 1 member b1 akr1b1 adr alr2 aldr1 aldehyde low km lii5 2 ctcl tumor antigen 35,853 da aldr_human 4502049 np_001619.1 p15121 nm_001628.2 q5u031 q6fga4 q6icp2 q9bs21 q9uci9 b2r8n3 103880 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision family1 lii52 range20
⇄⧉products_description => string (293) "Principle of the Assay: NR can catalyze the reduction of nitrate in plants a...
$value[13]['_source']['products_description']
Principle of the Assay: NR can catalyze the reduction of nitrate in plants and form nitrite. The produced nitrite can form red azo compounds with p-aminobenzenesulfonic acid and alpha-naphthylamine under acidic conditions. The NR activity can be calculated by measuring the OD value at 540 nm.
⇄⧉search_terms => string (301) "aaa22080 typical testing data standard curve for reference only aaa22080_sc ...
$value[13]['_source']['search_terms']
aaa22080 typical testing data standard curve for reference only aaa22080_sc assay kit nitrate reductase visible light method loc542278 nr nar1s nadh 69,773 da nia1_maize 803378384 p17571 nm_001305856.1 samples fresh plant tissue culture cells bacteria detection range 1.3 250u l sensitivity u range1.3
⇄⧉products_description => string (1341) "Intended Uses: This DHFR ELISA kit is a 1.5 hour solid-phase ELISA designed ...
$value[14]['_source']['products_description']
Intended Uses: This DHFR ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human DHFR. This ELISA kit for research use only!<br><br>Principle of the Assay: DHFR ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-DHFR antibody and an DHFR-HRP conjugate. The assay sample and buffer are incubated together with DHFR-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the DHFR concentration since DHFR from samples and DHFR-HRP conjugate compete for the anti-DHFR antibody binding site. Since the number of sites is limited, as more sites are occupied by DHFR from the sample, fewer sites are left to bind DHFR-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The DHFR concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[14]['_source']['products_references']
⇄⧉products_related_diseases => string (269) "Neoplasms, Experimental||115!!Disease Models, Animal||66!!Nervous System Dis...
⇄⧉search_terms => string (401) "aaa27073 human typical testing data standard curve for reference only aaa270...
$value[14]['_source']['search_terms']
aaa27073 human typical testing data standard curve for reference only aaa27073_td elisa kit dihydrofolate reductase dhfr aa607882 ai662710 aw555094 8430436i03rik 21,606 da dyr_mouse 7106289 np_034179.1 p00375 nm_010049.3 p70693 q61485 q61487 q61579 samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 0.1 ng ml sensitivity0.1
⇄specificity => string (21) "Recognizes human GSR."
$value[15]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[15]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[15]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[15]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[15]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 6ug/ml<br>Applications are based on unconjugated antibody."
$value[15]['_source']['app_notes']
⇄⧉testing_protocols => string (1004) "WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line...
$value[15]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25118_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.||AAA25118_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].||AAA25118_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.||AAA25118_WB3.jpg!!WB (Western Blot)||GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.||AAA25118_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.84kD).||AAA25118_WB.jpg
⇄⧉etc_term1 => string (280) "Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP...
$value[15]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR!!Conjugate||FITC
Nervous System Diseases||81!!Cardiovascular Diseases||50!!Liver Diseases||20!!Hypertension||16!!Inflammation||14!!Necrosis||13!!Drug-Induced Liver Injury||11!!Drug-Related Side Effects and Adverse Reactions||9!!Heart Diseases||9!!Poisoning||9
⇄⧉search_terms => string (1237) "aaa25118 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity c...
$value[15]['_source']['search_terms']
aaa25118 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes gsr elisa eia immunohistochemistry ihc paraffin western blot wb p 6ug ml applications are based on unconjugated antibody detection against immunogen 37.84kd aaa25118_wb analysis of expression imr 32 aaa25118_wb2 transfected 293t cell line lane 1 lysate 56.3kd 2 non aaa25118_wb3 immunoperoxidase to formalin fixed embedded salivary gland concentration aaa25118_ihc4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25118_td5 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25118_wb6 glutathione reductase mitochondrial gr grase glur grd1 mgc78522 isoform disulfide hel 75 s 122m 47,267 da gshr_human 50301238 np_000628 p00390 nm_000637 q7z5c9 q9np63 c8kil8 c8kil9 c8kim0 d3dsv3 138300 antibodies enzymes partial corresponding aa413 522 from tag mw the alone 26kd sequence tvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr conjugate ph7.2 imr32 lane1 56.3kd2 expressed293 hel75 aa413522
⇄specificity => string (21) "Recognizes human GSR."
$value[16]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[16]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[16]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 6ug/ml<br>Applications are based on unconjugated antibody."
$value[16]['_source']['app_notes']
⇄⧉testing_protocols => string (1004) "WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line...
$value[16]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25412_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.||AAA25412_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].||AAA25412_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.||AAA25412_WB3.jpg!!WB (Western Blot)||GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.||AAA25412_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.84kD).||AAA25412_WB.jpg
⇄⧉etc_term1 => string (279) "Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP...
$value[16]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR!!Conjugate||HRP
Nervous System Diseases||81!!Cardiovascular Diseases||50!!Liver Diseases||20!!Hypertension||16!!Inflammation||14!!Necrosis||13!!Drug-Induced Liver Injury||11!!Drug-Related Side Effects and Adverse Reactions||9!!Heart Diseases||9!!Poisoning||9
⇄⧉search_terms => string (1232) "aaa25412 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity c...
$value[16]['_source']['search_terms']
aaa25412 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes gsr elisa eia immunohistochemistry ihc paraffin western blot wb p 6ug ml applications are based on unconjugated antibody detection against immunogen 37.84kd aaa25412_wb analysis of expression imr 32 aaa25412_wb2 transfected 293t cell line lane 1 lysate 56.3kd 2 non aaa25412_wb3 immunoperoxidase to formalin fixed embedded salivary gland concentration aaa25412_ihc4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25412_td5 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25412_wb6 glutathione reductase mitochondrial gr grase glur grd1 mgc78522 isoform disulfide hel 75 s 122m 47,267 da gshr_human 50301238 np_000628 p00390 nm_000637 q7z5c9 q9np63 c8kil8 c8kil9 c8kim0 d3dsv3 138300 antibodies enzymes partial corresponding aa413 522 from tag mw the alone 26kd sequence tvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr conjugate ph7.2 imr32 lane1 56.3kd2 expressed293 hel75 aa413522
⇄specificity => string (21) "Recognizes human GSR."
$value[17]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[17]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[17]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[17]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[17]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 6ug/ml<br>Applications are based on unconjugated antibody."
$value[17]['_source']['app_notes']
⇄⧉testing_protocols => string (1004) "WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line...
$value[17]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24526_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.||AAA24526_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].||AAA24526_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.||AAA24526_WB3.jpg!!WB (Western Blot)||GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.||AAA24526_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.84kD).||AAA24526_WB.jpg
⇄⧉etc_term1 => string (279) "Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP...
$value[17]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR!!Conjugate||APC
Nervous System Diseases||81!!Cardiovascular Diseases||50!!Liver Diseases||20!!Hypertension||16!!Inflammation||14!!Necrosis||13!!Drug-Induced Liver Injury||11!!Drug-Related Side Effects and Adverse Reactions||9!!Heart Diseases||9!!Poisoning||9
⇄⧉search_terms => string (1225) "aaa24526 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity c...
$value[17]['_source']['search_terms']
aaa24526 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes gsr elisa eia immunohistochemistry ihc paraffin western blot wb p 6ug ml applications are based on unconjugated antibody detection against immunogen 37.84kd aaa24526_wb analysis of expression imr 32 aaa24526_wb2 transfected 293t cell line lane 1 lysate 56.3kd 2 non aaa24526_wb3 immunoperoxidase to formalin fixed embedded salivary gland concentration aaa24526_ihc4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa24526_td5 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24526_wb6 glutathione reductase mitochondrial gr grase glur grd1 mgc78522 isoform disulfide hel 75 s 122m 47,267 da gshr_human 50301238 np_000628 p00390 nm_000637 q7z5c9 q9np63 c8kil8 c8kil9 c8kim0 d3dsv3 138300 antibodies enzymes partial corresponding aa413 522 from tag mw the alone 26kd sequence tvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr conjugate ph7.2 imr32 lane1 56.3kd2 expressed293 hel75 aa413522
⇄specificity => string (21) "Recognizes human GSR."
$value[18]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[18]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[18]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[18]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[18]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 6ug/ml<br>Applications are based on unconjugated antibody."
$value[18]['_source']['app_notes']
⇄⧉testing_protocols => string (1004) "WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line...
$value[18]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24821_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.||AAA24821_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].||AAA24821_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.||AAA24821_WB3.jpg!!WB (Western Blot)||GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.||AAA24821_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.84kD).||AAA24821_WB.jpg
⇄⧉etc_term1 => string (282) "Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP...
$value[18]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR!!Conjugate||Biotin
Nervous System Diseases||81!!Cardiovascular Diseases||50!!Liver Diseases||20!!Hypertension||16!!Inflammation||14!!Necrosis||13!!Drug-Induced Liver Injury||11!!Drug-Related Side Effects and Adverse Reactions||9!!Heart Diseases||9!!Poisoning||9
⇄⧉search_terms => string (1212) "aaa24821 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity c...
$value[18]['_source']['search_terms']
aaa24821 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes gsr elisa eia immunohistochemistry ihc paraffin western blot wb p 6ug ml applications are based on unconjugated antibody detection against immunogen 37.84kd aaa24821_wb analysis of expression imr 32 aaa24821_wb2 transfected 293t cell line lane 1 lysate 56.3kd 2 non aaa24821_wb3 immunoperoxidase to formalin fixed embedded salivary gland concentration aaa24821_ihc4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa24821_td5 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24821_wb6 glutathione reductase mitochondrial gr grase glur grd1 mgc78522 isoform disulfide hel 75 s 122m 47,267 da gshr_human 50301238 np_000628 p00390 nm_000637 q7z5c9 q9np63 c8kil8 c8kil9 c8kim0 d3dsv3 138300 antibodies enzymes partial corresponding aa413 522 from tag mw the alone 26kd sequence tvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr conjugate ph7.2 imr32 lane1 56.3kd2 expressed293 hel75 aa413522
⇄specificity => string (21) "Recognizes human GSR."
$value[19]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[19]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[19]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[19]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[19]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 6ug/ml<br>Applications are based on unconjugated antibody."
$value[19]['_source']['app_notes']
⇄⧉testing_protocols => string (1004) "WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line...
$value[19]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25707_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.||AAA25707_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].||AAA25707_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.||AAA25707_WB3.jpg!!WB (Western Blot)||GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.||AAA25707_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.84kD).||AAA25707_WB.jpg
⇄⧉etc_term1 => string (278) "Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP...
$value[19]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR!!Conjugate||PE
Nervous System Diseases||81!!Cardiovascular Diseases||50!!Liver Diseases||20!!Hypertension||16!!Inflammation||14!!Necrosis||13!!Drug-Induced Liver Injury||11!!Drug-Related Side Effects and Adverse Reactions||9!!Heart Diseases||9!!Poisoning||9
⇄⧉search_terms => string (1224) "aaa25707 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity c...
$value[19]['_source']['search_terms']
aaa25707 mouse human monoclonal igg2a,k 6b4 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes gsr elisa eia immunohistochemistry ihc paraffin western blot wb p 6ug ml applications are based on unconjugated antibody detection against immunogen 37.84kd aaa25707_wb analysis of expression imr 32 aaa25707_wb2 transfected 293t cell line lane 1 lysate 56.3kd 2 non aaa25707_wb3 immunoperoxidase to formalin fixed embedded salivary gland concentration aaa25707_ihc4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25707_td5 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25707_wb6 glutathione reductase mitochondrial gr grase glur grd1 mgc78522 isoform disulfide hel 75 s 122m 47,267 da gshr_human 50301238 np_000628 p00390 nm_000637 q7z5c9 q9np63 c8kil8 c8kil9 c8kim0 d3dsv3 138300 antibodies enzymes partial corresponding aa413 522 from tag mw the alone 26kd sequence tvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr conjugate ph7.2 imr32 lane1 56.3kd2 expressed293 hel75 aa413522
