Rabbit anti-Human, Mouse MAGEA8 Polyclonal Antibody | anti-MAGEA8 antibody

MAGEA8 (Melanoma-associated Antigen 8, MAGE-8 Antigen, Cancer/Testis Antigen 1.8, CT1.8, MAGE8, MGC2182)

Cat. Num. AAA644121

• Gene Names: MAGEA8; CT1.8; MAGE8
• Reactivity: Human, Mouse
• Applications: Western Blot, Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: MAGEA8; Polyclonal Antibody; MAGEA8 (Melanoma-associated Antigen 8; MAGE-8 Antigen; Cancer/Testis Antigen 1.8; CT1.8; MAGE8; MGC2182); Anti -MAGEA8 (Melanoma-associated Antigen 8; anti-MAGEA8 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MAGEA8. Species Crossreactivity: mouse.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV

• Applicable Applications for anti-MAGEA8 antibody: Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: Suitable for use in Western Blot and Immunoprecipitation.
• Immunogen: Full length human MAGEA8, aa1-318 (NP_005355.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAGEA8 rabbit polyclonal antibody. Western Blot analysis of MAGEA8 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of MAGEA8 expression in transfected 293T cell line by MAGEA8 polyclonal antibody. Lane 1: MAGEA8 transfected lysate (35.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MAGEA8 transfected lysate using MAGEA8 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAGEA8 mouse polyclonal antibody.)

Western Blot (WB)

(MAGEA8 rabbit polyclonal antibody. Western Blot analysis of MAGEA8 expression in human kidney.)

Related Product Information for anti-MAGEA8 antibody

MAGEA8 is a member of the MAGEA gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 80% sequence identity between each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are expressed at a high level in a number of tumors of various histologic types, and are silent in normal tissues with the exception of testis and placenta. The MAGEA genes are clustered on chromosome Xq28. They may be implicated in some hereditary disorders, such as dyskeratosis congenita.. MAGEA8 may play a role in embryonal development and tumor transformation or aspects of tumor progression. It is expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.

Product Categories/Family for anti-MAGEA8 antibody

Antibodies; Abs to Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 19923308
• NCBI GeneID: 4107
• NCBI Accession #: NP_005355.2
• NCBI GenBank Nucleotide #: NM_005364.4
• UniProt Accession #: P43361; Q9BUN9
• Molecular Weight: 35,215 Da
• NCBI Official Full Name: melanoma-associated antigen 8
• NCBI Official Synonym Full Names: melanoma antigen family A, 8
• NCBI Official Symbol: MAGEA8
• NCBI Official Synonym Symbols: CT1.8; MAGE8
• NCBI Protein Information: melanoma-associated antigen 8; MAGE-8 antigen; cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8
• UniProt Protein Name: Melanoma-associated antigen 8
• Protein Family: Melanoma-associated antigen
• UniProt Gene Name: MAGEA8
• UniProt Synonym Gene Names: MAGE8; CT1.8
• UniProt Entry Name: MAGA8_HUMAN

NCBI Description

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Oct 2009]

Uniprot Description

MAGE-A8: Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq28