Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (COX4NB polyclonal antibody. Western Blot analysis of COX4NB expression in human placenta)

Mouse anti-Human EMC8 Polyclonal Antibody | anti-EMC8 antibody

EMC8 (ER Membrane Protein Complex Subunit 8, Neighbor of COX4, Protein FAM158B, C16orf2, C16orf4, COX4AL, COX4NB, FAM158B, NOC4)

Gene Names
EMC8; NOC4; COX4NB
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
EMC8; Polyclonal Antibody; EMC8 (ER Membrane Protein Complex Subunit 8; Neighbor of COX4; Protein FAM158B; C16orf2; C16orf4; COX4AL; COX4NB; FAM158B; NOC4); Anti -EMC8 (ER Membrane Protein Complex Subunit 8; anti-EMC8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human COX4NB.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Applicable Applications for anti-EMC8 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 20ug/ml
Immunogen
Full-length human COX4NB, aa1-210 (NP_006058.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(COX4NB polyclonal antibody. Western Blot analysis of COX4NB expression in human placenta)

Western Blot (WB) (COX4NB polyclonal antibody. Western Blot analysis of COX4NB expression in human placenta)

Western Blot (WB)

(Western Blot analysis of COX4NB expression in transfected 293T cell line by COX4NB polyclonal antibody. Lane1:COX4NB transfected lysate (23.1kD). Lane2:Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of COX4NB expression in transfected 293T cell line by COX4NB polyclonal antibody. Lane1:COX4NB transfected lysate (23.1kD). Lane2:Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to COX4NB on HepG2 cell. [antibody concentration 20ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to COX4NB on HepG2 cell. [antibody concentration 20ug/ml])
Related Product Information for anti-EMC8 antibody
Component of the ER membrane protein complex (EMC).
Product Categories/Family for anti-EMC8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,777 Da
NCBI Official Full Name
ER membrane protein complex subunit 8
NCBI Official Synonym Full Names
COX4 neighbor
NCBI Official Symbol
EMC8
NCBI Official Synonym Symbols
NOC4; COX4NB
NCBI Protein Information
ER membrane protein complex subunit 8; neighbor of COX4
UniProt Protein Name
ER membrane protein complex subunit 8
UniProt Gene Name
EMC8
UniProt Synonym Gene Names
COX4NB
UniProt Entry Name
EMC8_BOVIN

Uniprot Description

Subunit structure: Component of the ER membrane protein complex (EMC)

By similarity.

Subcellular location: Cytoplasm

By similarity.

Sequence similarities: Belongs to the EMC8/EMC9 family.

Similar Products

Product Notes

The EMC8 emc8 (Catalog #AAA642140) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EMC8 (ER Membrane Protein Complex Subunit 8, Neighbor of COX4, Protein FAM158B, C16orf2, C16orf4, COX4AL, COX4NB, FAM158B, NOC4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EMC8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 20ug/ml. Researchers should empirically determine the suitability of the EMC8 emc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGVKLTTQA YCKMVLHGAK YPHCAVNGLL VAEKQKPRKE HLPLGGPGAH HTLFVDCIPL FHGTLALAPM LEVALTLIDS WCKDHSYVIA GYYQANERVK DASPNQVAEK VASRIAEGFS DTALIMVDNT KFTMDCVAPT IHVYEHHENR WRCRDPHHDY CEDWPEAQRI SASLLDSRSY ETLVDFDNHL DDIRNDWTNP EINKAVLHLC. It is sometimes possible for the material contained within the vial of "EMC8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.