Mouse anti-Human WFDC5 Monoclonal Antibody
WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein)
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
WFDC5; Monoclonal Antibody; WFDC5 (PRG5; WAP1; WAP Four-disulfide Core Domain Protein 5; Putative Protease Inhibitor WAP1; p53-responsive Gene 5 Protein); Anti -WFDC5 (PRG5; anti-WFDC5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5G5
Specificity
Recognizes human WFDC5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG
Applicable Applications for anti-WFDC5 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant protein corresponding to aa25-124 from human WFDC5 (NP_663627) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-WFDC5 antibody
WFDC5 is a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq].
Product Categories/Family for anti-WFDC5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
WFDC5
Protein Family
Uniprot Description
WFDC5: Putative acid-stable proteinase inhibitor. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 20q13.12
Cellular Component: extracellular region
Molecular Function: serine-type endopeptidase inhibitor activity
Similar Products
Product Notes
The WFDC5 (Catalog #AAA641737) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WFDC5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the WFDC5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RKKGEKSGGC PPDDGPCLLS VPDQCVEDSQ CPLTRKCCYR ACFRQCVPRV SVKLGSCPED QLRCLSPMNH LCHKDSDCSG KKRCCHSACG RDCRDPARG. It is sometimes possible for the material contained within the vial of "WFDC5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
