Western Blot (WB)
(WB Suggested Anti-WFDC5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Rabbit WFDC5 Polyclonal Antibody | anti-WFDC5 antibody
WFDC5 antibody - N-terminal region
Gene Names
WFDC5; PRG5; WAP1; dJ211D12.5
Reactivity
Cow, Guinea Pig, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WFDC5; Polyclonal Antibody; WFDC5 antibody - N-terminal region; anti-WFDC5 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV
Sequence Length
123
Applicable Applications for anti-WFDC5 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 85%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WFDC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-WFDC5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-WFDC5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-WFDC5 antibody
This is a rabbit polyclonal antibody against WFDC5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.
Target Description: WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.
Product Categories/Family for anti-WFDC5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
WAP four-disulfide core domain protein 5
NCBI Official Synonym Full Names
WAP four-disulfide core domain 5
NCBI Official Symbol
WFDC5
NCBI Official Synonym Symbols
PRG5; WAP1; dJ211D12.5
NCBI Protein Information
WAP four-disulfide core domain protein 5
UniProt Protein Name
WAP four-disulfide core domain protein 5
Protein Family
UniProt Gene Name
WFDC5
UniProt Synonym Gene Names
PRG5; WAP1
NCBI Description
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq, Jul 2008]
Uniprot Description
Putative acid-stable proteinase inhibitor.
Research Articles on WFDC5
Similar Products
Product Notes
The WFDC5 wfdc5 (Catalog #AAA3211012) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WFDC5 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's WFDC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WFDC5 wfdc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRTQSLLLLG ALLAVGSQLP AVFGRKKGEK SGGCPPDDGP CLLSVPDQCV. It is sometimes possible for the material contained within the vial of "WFDC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
