Rabbit anti-Human POLR2L Polyclonal Antibody | anti-POLR2L antibody

POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (PE)

Cat. Num. AAA6390163

• Gene Names: POLR2L; RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLR2L; Polyclonal Antibody; POLR2L (DNA-directed RNA Polymerases I; II; and III Subunit RPABC5; RNA Polymerases I; and III Subunit ABC5; DNA-directed RNA Polymerase III Subunit L; RNA Polymerase II 7.6kD Subunit; RPB7.6; RPB10 Homolog) (PE); anti-POLR2L antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human POLR2L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-POLR2L antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human POLR2L, aa1-422 (NP_066951.1).
• Immunogen Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of POLR2L expression in transfected 293T cell line by POLR2L polyclonal antibody. Lane 1: POLR2L transfected lysate (7.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-POLR2L antibody

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft.

Product Categories/Family for anti-POLR2L antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 10863925
• NCBI GeneID: 5441
• NCBI Accession #: NP_066951.1
• NCBI GenBank Nucleotide #: NM_021128.3
• UniProt Accession #: P62875; P52436; Q6FHX3
• Molecular Weight: 7,645 Da
• NCBI Official Full Name: DNA-directed RNA polymerases I, II, and III subunit RPABC5
• NCBI Official Synonym Full Names: polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
• NCBI Official Symbol: POLR2L
• NCBI Official Synonym Symbols: RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta
• NCBI Protein Information: DNA-directed RNA polymerases I, II, and III subunit RPABC5; RPB10 homolog; RNA polymerase II 7.6 kDa subunit; DNA-directed RNA polymerase III subunit L; RNA polymerases I, II, and III subunit ABC5
• UniProt Protein Name: DNA-directed RNA polymerases I, II, and III subunit RPABC5
• UniProt Gene Name: POLR2L
• UniProt Synonym Gene Names: RNA polymerases I, II, and III subunit ABC5; RPB7.6
• UniProt Entry Name: RPAB5_HUMAN

Uniprot Description

POLR2L: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft. Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

Protein type: EC 2.7.7.6; Transcription initiation complex; Transferase; Nucleotide Metabolism - pyrimidine; DNA-binding; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; DNA-directed RNA polymerase II, core complex; nucleus; cytosol; DNA-directed RNA polymerase I complex

Molecular Function: DNA binding; zinc ion binding; DNA-directed RNA polymerase activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; regulation of transcription from RNA polymerase I promoter; termination of RNA polymerase III transcription; viral reproduction; positive regulation of viral transcription; somatic stem cell maintenance; RNA splicing; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; termination of RNA polymerase I transcription; DNA repair; regulation of gene expression, epigenetic; nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase III promoter; mRNA capping; nucleotide-excision repair; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; positive regulation of interferon type I production; innate immune response; gene expression; transcription initiation from RNA polymerase I promoter; RNA elongation from RNA polymerase III promoter