Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PDX1 rabbit polyclonal antibody. Western Blot analysis of PDX1 expression in human liver.)

Rabbit anti-Human, Mouse PDX1 Polyclonal Antibody | anti-PDX1 antibody

PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (Biotin)

Gene Names
PDX1; GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDX1; Polyclonal Antibody; PDX1 (Pancreas/Duodenum Homeobox Protein 1; PDX-1; Glucose-sensitive Factor; GSF; Insulin Promoter Factor 1; IPF-1; Insulin Upstream Factor 1; IUF-1; Islet/Duodenum Homeobox-1; IDX-1; Somatostatin-transactivating Factor 1; STF-1; IPF1; STF1) (Biotin); anti-PDX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PDX1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
913
Applicable Applications for anti-PDX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PDX1, aa1-283 (AAI11593.1).
Immunogen Sequence
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PDX1 rabbit polyclonal antibody. Western Blot analysis of PDX1 expression in human liver.)

Western Blot (WB) (PDX1 rabbit polyclonal antibody. Western Blot analysis of PDX1 expression in human liver.)

Western Blot (WB)

(PDX1 rabbit polyclonal antibody. Western Blot analysis of PDX1 expression in mouse liver.)

Western Blot (WB) (PDX1 rabbit polyclonal antibody. Western Blot analysis of PDX1 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of PDX1 expression in transfected 293T cell line by PDX1 polyclonal antibody. Lane 1: PDX1 transfected lysate (31.13kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDX1 expression in transfected 293T cell line by PDX1 polyclonal antibody. Lane 1: PDX1 transfected lysate (31.13kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PDX1 antibody
PDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain. It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription. During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4).
Product Categories/Family for anti-PDX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Synthetic construct Homo sapiens clone IMAGE:40080548, MGC:133411 PDX1 protein (PDX1) mRNA, encodes complete protein
NCBI Official Synonym Full Names
pancreatic and duodenal homeobox 1
NCBI Official Symbol
PDX1
NCBI Official Synonym Symbols
GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1
NCBI Protein Information
pancreas/duodenum homeobox protein 1

NCBI Description

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (IDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Aug 2017]

Research Articles on PDX1

Similar Products

Product Notes

The PDX1 (Catalog #AAA6388945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PDX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDX1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.