Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PAEP rabbit polyclonal antibody. Western Blot analysis of PAEP expression in human placenta.)

Rabbit anti-Human PAEP Polyclonal Antibody | anti-PAEP antibody

PAEP (Glycodelin, GD, Placental Protein 14, PP14, Pregnancy-associated Endometrial alpha-2 Globulin, PAEG, PEG, Progestagen-associated Endometrial Protein, Progesterone-associated Endometrial Protein) (FITC)

Gene Names
PAEP; GD; GdA; GdF; GdS; PEP; PAEG; PP14
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAEP; Polyclonal Antibody; PAEP (Glycodelin; GD; Placental Protein 14; PP14; Pregnancy-associated Endometrial alpha-2 Globulin; PAEG; PEG; Progestagen-associated Endometrial Protein; Progesterone-associated Endometrial Protein) (FITC); anti-PAEP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PAEP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-PAEP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PAEP, aa1-180 (NP_002562.2).
Immunogen Sequence
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PAEP rabbit polyclonal antibody. Western Blot analysis of PAEP expression in human placenta.)

Western Blot (WB) (PAEP rabbit polyclonal antibody. Western Blot analysis of PAEP expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of PAEP expression in transfected 293T cell line by PAEP polyclonal antibody. Lane 1: PAEP transfected lysate (20.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAEP expression in transfected 293T cell line by PAEP polyclonal antibody. Lane 1: PAEP transfected lysate (20.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PAEP antibody
PAEP (Progesterone-associated endometrial protein, glycodelin, PEG, PP14) is a glycoprotein belonging to lipocalin structural superfamily. It shares a sequence homology to beta-lactoglobulins containing a retinol-binding motif and it is mainly produced by secretory and decidualized endometrium in women and by seminal vesicle epithelium in men. PAEP function is not clearly understood. However, glycosylated version of PAEP (GdA) has been associated to contraceptive and immunosuppressive activities during reproduction. PAEP is the main protein produced by secretory endometrium during mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. Therefore, PAEP has been linked as an ideal biomarker of endometrial activity and function for in vitro fertilization treated women.
Product Categories/Family for anti-PAEP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,953 Da
NCBI Official Full Name
glycodelin
NCBI Official Synonym Full Names
progestagen-associated endometrial protein
NCBI Official Symbol
PAEP
NCBI Official Synonym Symbols
GD; GdA; GdF; GdS; PEP; PAEG; PP14
NCBI Protein Information
glycodelin; PEG; glycodelin-A; glycodelin-F; glycodelin-S; placental protein 14; alpha uterine protein; PP14 protein (placental protein 14); progesterone-associated endometrial protein; pregnancy-associated endometrial alpha-2 globulin; pregnancy-associat
UniProt Protein Name
Glycodelin
Protein Family
UniProt Gene Name
PAEP
UniProt Synonym Gene Names
GD; PP14; PAEG; PEG
UniProt Entry Name
PAEP_HUMAN

NCBI Description

This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. A number of alternatively spliced transcript variants have been observed at this locus, but the full-length nature of only two, each encoding the same protein, has been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PAEP: This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. Belongs to the calycin superfamily. Lipocalin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: extracellular region

Biological Process: transport; multicellular organismal development

Research Articles on PAEP

Similar Products

Product Notes

The PAEP paep (Catalog #AAA6388308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAEP (Glycodelin, GD, Placental Protein 14, PP14, Pregnancy-associated Endometrial alpha-2 Globulin, PAEG, PEG, Progestagen-associated Endometrial Protein, Progesterone-associated Endometrial Protein) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAEP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAEP paep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAEP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.