Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NAGA rabbit polyclonal antibody. Western Blot analysis of NAGA expression in human liver.)

Rabbit anti-Human NAGA Polyclonal Antibody | anti-NAGA antibody

NAGA (Alpha-N-acetylgalactosaminidase, Alpha-galactosidase B) (Biotin)

Gene Names
NAGA; GALB; D22S674
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAGA; Polyclonal Antibody; NAGA (Alpha-N-acetylgalactosaminidase; Alpha-galactosidase B) (Biotin); anti-NAGA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NAGA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NAGA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NAGA, aa1-411 (NP_000253.1).
Immunogen Sequence
MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NAGA rabbit polyclonal antibody. Western Blot analysis of NAGA expression in human liver.)

Western Blot (WB) (NAGA rabbit polyclonal antibody. Western Blot analysis of NAGA expression in human liver.)

Western Blot (WB)

(Western Blot analysis of NAGA expression in transfected 293T cell line by NAGA polyclonal antibody. Lane 1: NAGA transfected lysate (46.6kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of NAGA expression in transfected 293T cell line by NAGA polyclonal antibody. Lane 1: NAGA transfected lysate (46.6kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-NAGA antibody
NAGA is a lysosomal a-N-acetylgalactosaminidase that cleaves non-reducing a-N-acetylgalactosaminyl moieties from glycoconjugates. Mature NAGA has 394aa and is trafficked to the lysosome via the mannose-6-phosphate receptor-mediated pathway. The enzyme is a retaining exoglycosidase, where both the substrate and product of the enzymatic reaction have the same anomeric configuration. Deficiency in NAGA results in increased urinary excretion and tissue accumulation of glycopeptides and oligosaccharides containing terminal aNacetylgalactosaminyl moieties, manifesting as Schindler's disease, an autosomal recessive disease with neuroaxonal dystrophy and other neurological symptoms. The enzyme can be used to remove a-N-acetylgalactosaminyl residues present on red blood cells thus converting blood type A to blood type O.
Product Categories/Family for anti-NAGA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,565 Da
NCBI Official Full Name
alpha-N-acetylgalactosaminidase
NCBI Official Synonym Full Names
alpha-N-acetylgalactosaminidase
NCBI Official Symbol
NAGA
NCBI Official Synonym Symbols
GALB; D22S674
NCBI Protein Information
alpha-N-acetylgalactosaminidase
UniProt Protein Name
Alpha-N-acetylgalactosaminidase
UniProt Gene Name
NAGA

NCBI Description

NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). [provided by RefSeq, Jul 2008]

Uniprot Description

NAGA: Removes terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. Required for the breakdown of glycolipids. Defects in NAGA are the cause of Schindler disease (SCHIND). Schindler disease is a form of NAGA deficiency characterized by early onset neuroaxonal dystrophy and neurological signs (convulsion during fever, epilepsy, psychomotor retardation and hypotonia). NAGA deficiency is typically classified in three main phenotypes: NAGA deficiency type I (Schindler disease or Schindler disease type I) with severe manifestations; NAGA deficiency type II (Kanzazi disease or Schindler disease type II) which is mild; NAGA deficiency type III (Schindler disease type III) characterized by mild-to-moderate neurologic manifestations. NAGA deficiency results in the increased urinary excretion of glycopeptides and oligosaccharides containing alpha-N-acetylgalactosaminyl moieties. Inheritance is autosomal recessive. Defects in NAGA are the cause of Kanzaki disease (KANZD); also known as NAGA deficiency type II or Schindler disease type II. Kanzaki disease is an autosomal recessive disorder characterized by late onset, angiokeratoma corporis diffusum and mild intellectual impairment. Belongs to the glycosyl hydrolase 27 family.

Protein type: EC 3.2.1.49; Glycan Metabolism - glycosphingolipid biosynthesis - globo series; Hydrolase

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytoplasm

Molecular Function: alpha-galactosidase activity; alpha-N-acetylgalactosaminidase activity; protein homodimerization activity

Biological Process: carbohydrate catabolic process; glycolipid catabolic process; glycoside catabolic process

Disease: Kanzaki Disease; Schindler Disease, Type I

Research Articles on NAGA

Similar Products

Product Notes

The NAGA naga (Catalog #AAA6386448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAGA (Alpha-N-acetylgalactosaminidase, Alpha-galactosidase B) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAGA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAGA naga for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.