Rabbit anti-Human MBD5 Polyclonal Antibody | anti-MBD5 antibody

MBD5 (Methyl-CpG-binding Domain Protein 5, Methyl-CpG-binding Protein MBD5, KIAA1461, FLJ11113, FLJ30517) (Biotin)

Cat. Num. AAA6385040

• Gene Names: MBD5; MRD1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MBD5; Polyclonal Antibody; MBD5 (Methyl-CpG-binding Domain Protein 5; Methyl-CpG-binding Protein MBD5; KIAA1461; FLJ11113; FLJ30517) (Biotin); anti-MBD5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MBD5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1639

• Applicable Applications for anti-MBD5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MBD5, aa1-229 (AAH14534.1).
• Immunogen Sequence: MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in human liver.)

Western Blot (WB)

(MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of MBD5 expression in transfected 293T cell line by MBD5 polyclonal antibody. Lane 1: MBD5 transfected lysate (24.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MBD5 antibody

Binds to heterochromatin. Does not interact with either methylated or unmethylated DNA (in vitro).

Product Categories/Family for anti-MBD5 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15778910
• NCBI GeneID: 55777
• NCBI Official Full Name: Homo sapiens methyl-CpG binding domain protein 5, mRNA
• NCBI Official Synonym Full Names: methyl-CpG binding domain protein 5
• NCBI Official Symbol: MBD5
• NCBI Official Synonym Symbols: MRD1
• NCBI Protein Information: methyl-CpG-binding domain protein 5
• Protein Family: Methyl-CpG-binding domain protein

NCBI Description

This gene encodes a member of the methyl-CpG-binding domain (MBD) family. The MBD consists of about 70 residues and is the minimal region required for a methyl-CpG-binding protein binding specifically to methylated DNA. In addition to the MBD domain, this protein contains a PWWP domain (Pro-Trp-Trp-Pro motif), which consists of 100-150 amino acids and is found in numerous proteins that are involved in cell division, growth and differentiation. Mutations in this gene cause an autosomal dominant type of cognitive disability. The encoded protein interacts with the polycomb repressive complex PR-DUB which catalyzes the deubiquitination of a lysine residue of histone 2A. Haploinsufficiency of this gene is associated with a syndrome involving microcephaly, intellectual disabilities, severe speech impairment, and seizures. Alternatively spliced transcript variants have been found, but their full-length nature is not determined. [provided by RefSeq, Jul 2017]