Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in human liver.)

Rabbit anti-Human MBD5 Polyclonal Antibody | anti-MBD5 antibody

MBD5 (Methyl-CpG-binding Domain Protein 5, Methyl-CpG-binding Protein MBD5, KIAA1461, FLJ11113, FLJ30517) (HRP)

Gene Names
MBD5; MRD1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MBD5; Polyclonal Antibody; MBD5 (Methyl-CpG-binding Domain Protein 5; Methyl-CpG-binding Protein MBD5; KIAA1461; FLJ11113; FLJ30517) (HRP); anti-MBD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MBD5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
1639
Applicable Applications for anti-MBD5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MBD5, aa1-229 (AAH14534.1).
Immunogen Sequence
MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in human liver.)

Western Blot (WB) (MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in human liver.)

Western Blot (WB)

(MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in HepG2.)

Western Blot (WB) (MBD5 rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of MBD5 expression in transfected 293T cell line by MBD5 polyclonal antibody. Lane 1: MBD5 transfected lysate (24.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MBD5 expression in transfected 293T cell line by MBD5 polyclonal antibody. Lane 1: MBD5 transfected lysate (24.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MBD5 antibody
Binds to heterochromatin. Does not interact with either methylated or unmethylated DNA (in vitro).
Product Categories/Family for anti-MBD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens methyl-CpG binding domain protein 5, mRNA
NCBI Official Synonym Full Names
methyl-CpG binding domain protein 5
NCBI Official Symbol
MBD5
NCBI Official Synonym Symbols
MRD1
NCBI Protein Information
methyl-CpG-binding domain protein 5

NCBI Description

This gene encodes a member of the methyl-CpG-binding domain (MBD) family. The MBD consists of about 70 residues and is the minimal region required for a methyl-CpG-binding protein binding specifically to methylated DNA. In addition to the MBD domain, this protein contains a PWWP domain (Pro-Trp-Trp-Pro motif), which consists of 100-150 amino acids and is found in numerous proteins that are involved in cell division, growth and differentiation. Mutations in this gene cause an autosomal dominant type of cognitive disability. The encoded protein interacts with the polycomb repressive complex PR-DUB which catalyzes the deubiquitination of a lysine residue of histone 2A. Haploinsufficiency of this gene is associated with a syndrome involving microcephaly, intellectual disabilities, severe speech impairment, and seizures. Alternatively spliced transcript variants have been found, but their full-length nature is not determined. [provided by RefSeq, Jul 2017]

Research Articles on MBD5

Similar Products

Product Notes

The MBD5 (Catalog #AAA6385042) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBD5 (Methyl-CpG-binding Domain Protein 5, Methyl-CpG-binding Protein MBD5, KIAA1461, FLJ11113, FLJ30517) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MBD5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MBD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.