Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAP2K6 expression in transfected 293T cell line by MAP2K6 polyclonal antibody. Lane 1: MAP2K6 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MAP2K6 Polyclonal Antibody | anti-MAP2K6 antibody

MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK Kinase 3, SAPKK3, SAPKK-3, SKK3) (AP)

Gene Names
MAP2K6; MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; SAPKK-3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP2K6; Polyclonal Antibody; MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6; MAP Kinase Kinase 6; MAPKK 6; MAPKK6; MKK6; PRKMK6; MAPK/ERK Kinase 6; MEK 6; MEK6; Stress-activated Protein Kinase Kinase 3; SAPK Kinase 3; SAPKK3; SAPKK-3; SKK3) (AP); anti-MAP2K6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAP2K6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAP2K6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MAP2K6, aa1-334 (NP_002749.2).
Immunogen Sequence
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAP2K6 expression in transfected 293T cell line by MAP2K6 polyclonal antibody. Lane 1: MAP2K6 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAP2K6 expression in transfected 293T cell line by MAP2K6 polyclonal antibody. Lane 1: MAP2K6 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K6 and GADD45A HeLa cells were stained with MAP2K6 rabbit purified polyclonal 1:1200 and GADD45A mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K6 and GADD45A HeLa cells were stained with MAP2K6 rabbit purified polyclonal 1:1200 and GADD45A mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-MAP2K6 antibody
MKK6 is a novel mitogen-activated protein kinase kinase which is a member of the p38 kinase cascade and efficiently phosphorylates p38 but not c-Jun N-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) family members in direct kinase assays. The protein is strongly activated by UV, anisomycin, and osmotic shock. MKK6 exists in a variety of alternatively spliced isoforms with distinct patterns of tissue expression. The protein usually phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. Human MKK6 gene is mapped on chromosomal region 17q24.3.
Product Categories/Family for anti-MAP2K6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,492 Da
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 6
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 6
NCBI Official Symbol
MAP2K6
NCBI Official Synonym Symbols
MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; SAPKK-3
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 6; MEK 6; MAPKK 6; SAPK kinase 3; MAPK/ERK kinase 6; stress-activated protein kinase kinase 3; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6)
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 6
UniProt Gene Name
MAP2K6
UniProt Synonym Gene Names
MEK6; MKK6; PRKMK6; SKK3; MAP kinase kinase 6; MAPKK 6; MEK 6; SAPK kinase 3; SAPKK-3; SAPKK3
UniProt Entry Name
MP2K6_HUMAN

NCBI Description

This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

MKK6: a dual-specificity protein kinase of the STE7 family. Activates p38 MAP kinase by phosphorylating a Thr and a Tyr residue in the activation loop. Is activated by cytokines and environmental stress in vivo. Three alternatively spliced isoforms have been reported.

Protein type: EC 2.7.12.2; Protein kinase, dual-specificity (non-receptor); Protein kinase, STE; Kinase, protein; STE group; STE7 family

Chromosomal Location of Human Ortholog: 17q24.3

Cellular Component: nucleoplasm; cytoskeleton; cytosol

Molecular Function: MAP kinase kinase activity; protein binding; protein-tyrosine kinase activity; protein kinase binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: peptidyl-tyrosine phosphorylation; DNA damage induced protein phosphorylation; activation of MAPK activity; positive regulation of apoptosis; apoptosis; stress-activated MAPK cascade; pathogenesis; toll-like receptor 3 signaling pathway; signal transduction; toll-like receptor 10 signaling pathway; ovulation cycle process; toll-like receptor 5 signaling pathway; regulation of transcription, DNA-dependent; cell cycle arrest; toll-like receptor 4 signaling pathway; cardiac muscle contraction; response to drug; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; muscle cell differentiation; positive regulation of prostaglandin secretion; toll-like receptor signaling pathway; positive regulation of muscle cell differentiation; innate immune response; toll-like receptor 9 signaling pathway; positive regulation of nitric-oxide synthase biosynthetic process

Research Articles on MAP2K6

Similar Products

Product Notes

The MAP2K6 map2k6 (Catalog #AAA6384807) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK Kinase 3, SAPKK3, SAPKK-3, SKK3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2K6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP2K6 map2k6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP2K6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.