Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAP2K6 monoclonal antibody Western Blot analysis of MAP2K6 expression in COLO 320 HSR.)

Mouse anti-Human MAP2K6 Monoclonal Antibody | anti-MAP2K6 antibody

MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK Kinase 3, SAPKK3, SAPKK-3, SKK3) (HRP)

Gene Names
MAP2K6; MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; SAPKK-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP2K6; Monoclonal Antibody; MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6; MAP Kinase Kinase 6; MAPKK 6; MAPKK6; MKK6; PRKMK6; MAPK/ERK Kinase 6; MEK 6; MEK6; Stress-activated Protein Kinase Kinase 3; SAPK Kinase 3; SAPKK3; SAPKK-3; SKK3) (HRP); anti-MAP2K6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F2
Specificity
Recognizes human MAP2K6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MAP2K6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa231-335, from human MAP2K6 (AAH12009) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAP2K6 monoclonal antibody Western Blot analysis of MAP2K6 expression in COLO 320 HSR.)

Western Blot (WB) (MAP2K6 monoclonal antibody Western Blot analysis of MAP2K6 expression in COLO 320 HSR.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP2K6 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAP2K6 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAP2K6 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAP2K6 is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K3 and MAP2K6 HeLa cells were stained with MAP2K3 rabbit purified polyclonal 1:1200 and MAP2K6 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K3 and MAP2K6 HeLa cells were stained with MAP2K3 rabbit purified polyclonal 1:1200 and MAP2K6 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-MAP2K6 antibody
MKK6 is a novel mitogen-activated protein kinase kinase which is a member of the p38 kinase cascade and efficiently phosphorylates p38 but not c-Jun N-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) family members in direct kinase assays. The protein is strongly activated by UV, anisomycin, and osmotic shock. MKK6 exists in a variety of alternatively spliced isoforms with distinct patterns of tissue expression. The protein usually phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. Human MKK6 gene is mapped on chromosomal region 17q24.3.
Product Categories/Family for anti-MAP2K6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
31,339 Da
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase kinase 6, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 6
NCBI Official Symbol
MAP2K6
NCBI Official Synonym Symbols
MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; SAPKK-3
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 6

NCBI Description

This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008]

Research Articles on MAP2K6

Similar Products

Product Notes

The MAP2K6 (Catalog #AAA6153411) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK Kinase 3, SAPKK3, SAPKK-3, SKK3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2K6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP2K6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP2K6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.