Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LYPLA1 expression in transfected 293T cell line by LYPLA1 polyclonal antibody. Lane 1: LYPLA1 transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LYPLA1 Polyclonal Antibody | anti-LYPLA1 antibody

LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (AP)

Gene Names
LYPLA1; LPL1; APT-1; hAPT1; LYSOPLA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LYPLA1; Polyclonal Antibody; LYPLA1 (APT1; LPL1; Acyl-protein Thioesterase 1; Lysophospholipase 1; Lysophospholipase I) (AP); anti-LYPLA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LYPLA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LYPLA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human LYPLA1, aa1-230 (NP_006321.1).
Immunogen Sequence
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LYPLA1 expression in transfected 293T cell line by LYPLA1 polyclonal antibody. Lane 1: LYPLA1 transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LYPLA1 expression in transfected 293T cell line by LYPLA1 polyclonal antibody. Lane 1: LYPLA1 transfected lysate (24.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LYPLA1 antibody
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Product Categories/Family for anti-LYPLA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,670 Da
NCBI Official Full Name
acyl-protein thioesterase 1
NCBI Official Synonym Full Names
lysophospholipase I
NCBI Official Symbol
LYPLA1
NCBI Official Synonym Symbols
LPL1; APT-1; hAPT1; LYSOPLA
NCBI Protein Information
acyl-protein thioesterase 1; LPL-I; lysoPLA I; lysophospholipase 1; acyl-protein thioesterase-1; lysophospholipid-specific lysophospholipase
UniProt Protein Name
Acyl-protein thioesterase 1
UniProt Gene Name
LYPLA1
UniProt Synonym Gene Names
APT1; LPL1; APT-1; hAPT1; LPL-I; LysoPLA I
UniProt Entry Name
LYPA1_HUMAN

NCBI Description

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008]

Uniprot Description

LYPLA1: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity. Belongs to the AB hydrolase 2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - glycerophospholipid; Phospholipase; EC 3.1.2.-

Chromosomal Location of Human Ortholog: 8q11.23

Cellular Component: mitochondrion; cytosol

Molecular Function: palmitoyl-(protein) hydrolase activity; lysophospholipase activity

Biological Process: negative regulation of Golgi to plasma membrane protein transport; regulation of nitric-oxide synthase activity; fatty acid metabolic process; nitric oxide metabolic process; protein depalmitoylation

Research Articles on LYPLA1

Similar Products

Product Notes

The LYPLA1 lypla1 (Catalog #AAA6384510) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LYPLA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LYPLA1 lypla1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LYPLA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.