Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ISG15 expression in human spleen using 128601.)

Rabbit anti-Human, Mouse ISG15 Polyclonal Antibody | anti-ISG15 antibody

ISG15 (Interferon-induced 17kD Protein, Ubiquitin Cross-reactive Protein, hUCRP, Interferon-induced 15kD Protein,G1P2, UCRP, Ubiquitin-like Protein ISG15, IP17) (Biotin)

Gene Names
ISG15; G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified
Synonyms
ISG15; Polyclonal Antibody; ISG15 (Interferon-induced 17kD Protein; Ubiquitin Cross-reactive Protein; hUCRP; Interferon-induced 15kD Protein; G1P2; UCRP; Ubiquitin-like Protein ISG15; IP17) (Biotin); anti-ISG15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ISG15. Species Crossreactivity: mouse
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
634
Applicable Applications for anti-ISG15 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-165 from human ISG15 (ENSP00000368699).
Immunogen Sequence
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ISG15 expression in human spleen using 128601.)

Western Blot (WB) (Western Blot analysis of ISG15 expression in human spleen using 128601.)

Western Blot (WB)

(Western Blot analysis of ISG15 expression in mouse kidney using 128601.)

Western Blot (WB) (Western Blot analysis of ISG15 expression in mouse kidney using 128601.)

Western Blot (WB)

(Western Blot analysis of ISG15 expression in HeLa cells using 128601.)

Western Blot (WB) (Western Blot analysis of ISG15 expression in HeLa cells using 128601.)

Western Blot (WB)

(Western Blot analysis of ISG15 expression in transfected 293T cell line using 128601. Lane 1: ISG15 transfected lysate (17.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ISG15 expression in transfected 293T cell line using 128601. Lane 1: ISG15 transfected lysate (17.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ISG15 antibody
ISG15 is secreted from monocytes in response to type I interferons and causes natural killer (NK)-cell proliferation and an augmentation of non-MCH (major histocompatibility complex)-restricted cytotoxicity. Synthesis is stimulated by IFN-alpha or IFN-beta or IFN-omega, but not IFN-gamma. ISG15 expression is also induced by overexpression of interferon regulatory factors that participate in transcriptional regulation of IFN genes, and by influenza B virus. ISG15 is secreted also by cell lines of monocyte, T-lymphocyte, B-lymphocyte, human fibroblasts, and epithelial origins. The induction of terminal differentiation in human melanoma cells is associated with alterations in ISG15 expression. Enhancement of NK cell proliferation, augmentation of non-major histocompatibility complex-restricted cytotoxicity, and induction of IFN-gamma from T cells identify ISG15 as a member of the cytokine cascade and suggest that it may be responsible for amplifying and directing some of the immunomodulatory effects of IFN-alpha or IFN-beta. ISG15 has has also been shown to function intracellularly as a ubiquitin homolog.
Product Categories/Family for anti-ISG15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens ISG15 ubiquitin-like modifier (ISG15), mRNA
NCBI Official Synonym Full Names
ISG15 ubiquitin like modifier
NCBI Official Symbol
ISG15
NCBI Official Synonym Symbols
G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
NCBI Protein Information
ubiquitin-like protein ISG15
Protein Family

NCBI Description

The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]

Research Articles on ISG15

Similar Products

Product Notes

The ISG15 (Catalog #AAA6383137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ISG15 (Interferon-induced 17kD Protein, Ubiquitin Cross-reactive Protein, hUCRP, Interferon-induced 15kD Protein,G1P2, UCRP, Ubiquitin-like Protein ISG15, IP17) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ISG15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ISG15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ISG15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.