Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ING1 expression in transfected 293T cell line by ING1 polyclonal antibody. Lane 1: ING1 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ING1 Polyclonal Antibody | anti-ING1 antibody

ING1 (Inhibitor of Growth Protein 1) (Biotin)

Gene Names
ING1; p33; p47; p33ING1; p24ING1c; p33ING1b; p47ING1a
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ING1; Polyclonal Antibody; ING1 (Inhibitor of Growth Protein 1) (Biotin); anti-ING1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ING1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ING1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ING1, aa1-279 (NP_937862.1).
Immunogen Sequence
MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ING1 expression in transfected 293T cell line by ING1 polyclonal antibody. Lane 1: ING1 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ING1 expression in transfected 293T cell line by ING1 polyclonal antibody. Lane 1: ING1 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ING1 antibody
The ING1 (inhibitor of growth) tumor suppressor protein shares a number of biological functions that are very similar with p53. The human ING1 gene contains three exons and two introns. There are four alternative splice variants produced from three different promoter regions (p33 ING1, p24 ING1, p27 ING1, p47 ING1). A number of studies have concluded that ING1 can influence a number of biological functions, which might be dependent on the variant that is expressed. The ING1 family has been reported to mediate growth arrest, senescence, anchorage-dependent growth and apoptosis, as well as influence chemosensitivity.
Product Categories/Family for anti-ING1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
~38 kDa
NCBI Official Full Name
Homo sapiens inhibitor of growth family, member 1 (ING1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
inhibitor of growth family, member 1
NCBI Official Symbol
ING1
NCBI Official Synonym Symbols
p33; p47; p33ING1; p24ING1c; p33ING1b; p47ING1a
NCBI Protein Information
inhibitor of growth protein 1; growth inhibitor ING1; tumor suppressor ING1; growth inhibitory protein ING1
UniProt Protein Name
Inhibitor of growth protein 1
UniProt Gene Name
ING1
UniProt Entry Name
ING1_HUMAN

NCBI Description

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

ING1: Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene. Defects in ING1 are a cause of head and neck squamous cell carcinomas (HNSCC); also known as squamous cell carcinoma of the head and neck. Belongs to the ING family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: nucleus

Molecular Function: protein binding; zinc ion binding; methylated histone residue binding

Biological Process: negative regulation of cell proliferation; protein import into nucleus; positive regulation of transcription, DNA-dependent; chromatin modification; negative regulation of cell growth; cell cycle

Disease: Squamous Cell Carcinoma, Head And Neck

Research Articles on ING1

Similar Products

Product Notes

The ING1 ing1 (Catalog #AAA6382884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ING1 (Inhibitor of Growth Protein 1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ING1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ING1 ing1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ING1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.