Rabbit anti-Human, Mouse GLRX3 Polyclonal Antibody | anti-GLRX3 antibody

GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) (HRP)

Cat. Num. AAA6379883

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GLRX3; Polyclonal Antibody; GLRX3 (Glutaredoxin-3; PKC-interacting Cousin of Thioredoxin; PICOT; PKC-theta-interacting Protein; PKCq-interacting Protein; Thioredoxin-like Protein 2; TXNL2; HUSSY-22; bA500G10.4; FLJ11864) (HRP); anti-GLRX3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GLRX3. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-GLRX3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human GLRX3, aa1-335 (NP_006532.2).
• Immunogen Sequence: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in human pancreas.)

Western Blot (WB)

(GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in mouse liver.)

Western Blot (WB)

(GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of GLRX3 expression in transfected 293T cell line by GLRX3 polyclonal antibody. Lane 1: GLRX3 transfected lysate (37.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GLRX3 antibody

PKCq is a member of the novel, Ca(2+)-independent PKC subfamily, which plays an important and non-redundant role in several aspects of T cell biology. Mutation of PKCq gene leads to impaired receptor-induced stimulation of the transcription factors AP-1, NF-kappaB and NFAT, which results in defective T cell activation, and to aberrant expression of apoptosis-related proteins, resulting in poor T cell survival. It is the major isoform of PKC that is involved in NF-kB activation induced by CD3-CD28 costimulation. PKCq is expressed mostly in skeletal muscle, megakaryoblastic cells and platelets. Human PKCq gene is localized on human chromosome 10p15.

Product Categories/Family for anti-GLRX3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 95113651
• NCBI Accession #: NP_006532.2
• NCBI GenBank Nucleotide #: NM_006541.2
• UniProt Accession #: O76003
• NCBI Official Full Name: glutaredoxin-3 isoform 1
• UniProt Protein Name: Glutaredoxin-3
• Protein Family: Glutaredoxin
• UniProt Gene Name: GLRX3
• UniProt Synonym Gene Names: PICOT; TXNL2; PICOT; PKCq-interacting protein
• UniProt Entry Name: GLRX3_HUMAN

Uniprot Description

GLRX3: Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: cell cortex; Z disc

Molecular Function: protein binding; electron carrier activity; protein kinase C binding; metal ion binding; iron-sulfur cluster binding; protein disulfide oxidoreductase activity

Biological Process: cell redox homeostasis; regulation of the force of heart contraction