Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ERBB3 expression in transfected 293T cell line by ERBB3 polyclonal antibody. Lane 1: ERBB3 transfected lysate (36.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ERBB3 Polyclonal Antibody | anti-ERBB3 antibody

ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) (FITC)

Gene Names
ERBB3; HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ERBB3; Polyclonal Antibody; ERBB3 (Receptor Tyrosine-protein Kinase erbB-3; Proto-oncogene-like Protein c-ErbB-3; Tyrosine Kinase-type Cell Surface Receptor HER3; HER3) (FITC); anti-ERBB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ERBB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
2755
Applicable Applications for anti-ERBB3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ERBB3, aa1-331 (AAH02706.1).
Immunogen Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ERBB3 expression in transfected 293T cell line by ERBB3 polyclonal antibody. Lane 1: ERBB3 transfected lysate (36.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ERBB3 expression in transfected 293T cell line by ERBB3 polyclonal antibody. Lane 1: ERBB3 transfected lysate (36.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with ERBB3 rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with ERBB3 rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-ERBB3 antibody
ErbB3, a member of the EGF receptor family, binds and is activated by neuregulins and NTAK. It potentially forms a heterodimer with each of the other ERBB receptors. This protein is predominantly expressed in epithelial tissues and brain. The cytoplasmic part of the receptor may interact with the SH2 or SH3 domains of many signal-transducing proteins. Ligand-binding may increase phosphorylation on tyrosine residues and promote its association with the p85 subunit of phosphatidylinositol 3-kinase ErbB3 is overexpressed in a subset of human mammary tumors.
Product Categories/Family for anti-ERBB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian), mRNA
NCBI Official Synonym Full Names
erb-b2 receptor tyrosine kinase 3
NCBI Official Symbol
ERBB3
NCBI Official Synonym Symbols
HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
NCBI Protein Information
receptor tyrosine-protein kinase erbB-3

NCBI Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Research Articles on ERBB3

Similar Products

Product Notes

The ERBB3 (Catalog #AAA6377594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERBB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERBB3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERBB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.