Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CTSS expression in transfected 293T cell line by CTSS polyclonal antibody. Lane 1: CTSS transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CTSS Polyclonal Antibody | anti-CTSS antibody

CTSS (Cathepsin S, MGC3886) APC

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTSS; Polyclonal Antibody; CTSS (Cathepsin S; MGC3886) APC; anti-CTSS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CTSS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CTSS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CTSS, aa1-331 (NP_004070.3).
Immunogen Sequence
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CTSS expression in transfected 293T cell line by CTSS polyclonal antibody. Lane 1: CTSS transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CTSS expression in transfected 293T cell line by CTSS polyclonal antibody. Lane 1: CTSS transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CTSS antibody
Cathepsin family of proteases contains several diverse classes of enzymes. The cysteine protease class comprises cathepsin B, H, K, L, O, and S. The aspartyl protease class contains cathepsin D and E. Cathepsin G belongs to the serine protease class. Cathepsins are involved in various cellular events such as peptide biosynthesis, protein degradation, and apoptosis. Cathepsin S has been shown to be present in aveloar macrophages.
Product Categories/Family for anti-CTSS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,626 Da
NCBI Official Full Name
cathepsin S isoform 1 preproprotein
NCBI Official Synonym Full Names
cathepsin S
NCBI Official Symbol
CTSS
NCBI Protein Information
cathepsin S
UniProt Protein Name
Cathepsin S
Protein Family
UniProt Gene Name
CTSS
UniProt Entry Name
CATS_HUMAN

Uniprot Description

CTSS: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Belongs to the peptidase C1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.27

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: lysosomal lumen; extracellular space; intracellular membrane-bound organelle; membrane; lysosome; extracellular region

Molecular Function: collagen binding; proteoglycan binding; cysteine-type endopeptidase activity; fibronectin binding; laminin binding

Biological Process: adaptive immune response; extracellular matrix organization and biogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of exogenous peptide antigen via MHC class II; proteolysis; collagen catabolic process; antigen processing and presentation; extracellular matrix disassembly; antigen processing and presentation of peptide antigen via MHC class I; proteolysis involved in cellular protein catabolic process; toll-like receptor signaling pathway; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; positive regulation of inflammatory response

Similar Products

Product Notes

The CTSS ctss (Catalog #AAA6375084) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTSS (Cathepsin S, MGC3886) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTSS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTSS ctss for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTSS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.