Rabbit anti-Human CRHBP Polyclonal Antibody | anti-CRHBP antibody

CRHBP (Corticotropin-releasing Hormone-binding Protein, CRH-BP, Corticotropin-Releasing Factor-binding Protein, CRF-binding Protein, CRF-BP, CRFBP) (PE)

Cat. Num. AAA6374730

• Gene Names: CRHBP; CRFBP; CRF-BP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRHBP; Polyclonal Antibody; CRHBP (Corticotropin-releasing Hormone-binding Protein; CRH-BP; Corticotropin-Releasing Factor-binding Protein; CRF-binding Protein; CRF-BP; CRFBP) (PE); anti-CRHBP antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CRHBP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CRHBP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CRHBP, aa1-322 (NP_001873.2).
• Immunogen Sequence: MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CRHBP rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.)

Western Blot (WB)

(Western Blot analysis of CRHBP expression in transfected 293T cell line by CRHBP polyclonal antibody. Lane 1: CRHBP transfected lysate (36.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CRHBP antibody

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein (CRHBP) which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy.

Product Categories/Family for anti-CRHBP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 47080099
• NCBI GeneID: 1393
• NCBI Accession #: NP_001873.2
• NCBI GenBank Nucleotide #: NM_001882.3
• UniProt Accession #: P24387; Q53F32; Q6FHT5
• Molecular Weight: 36,144 Da
• NCBI Official Full Name: corticotropin-releasing factor-binding protein
• NCBI Official Synonym Full Names: corticotropin releasing hormone binding protein
• NCBI Official Symbol: CRHBP
• NCBI Official Synonym Symbols: CRFBP; CRF-BP
• NCBI Protein Information: corticotropin-releasing factor-binding protein; CRF-binding protein; CRH-BP; corticotropin releasing hormone-binding protein; corticotropin-releasing hormone-binding protein
• UniProt Protein Name: Corticotropin-releasing factor-binding protein
• Protein Family: Corticotropin-releasing factor-binding protein
• UniProt Gene Name: CRHBP
• UniProt Synonym Gene Names: CRFBP; CRF-BP; CRF-binding protein; CRH-BP
• UniProt Entry Name: CRHBP_HUMAN

NCBI Description

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]

Uniprot Description

CRHBP: Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy. Belongs to the CRF-binding protein family.

Protein type: Secreted, signal peptide; Inhibitor; Secreted

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: Golgi apparatus; multivesicular body; extracellular space; microtubule; endoplasmic reticulum; dendrite; perikaryon; intracellular; nerve terminal; nucleus; secretory granule

Molecular Function: protein binding; corticotropin-releasing hormone binding; peptide binding

Biological Process: negative regulation of adrenocorticotropic hormone secretion; regulated secretory pathway; synaptic transmission, dopaminergic; learning and/or memory; hormone-mediated signaling; cellular response to stress; regulation of adrenocorticotropin hormone secretion; hormone metabolic process; female pregnancy; behavioral response to ethanol; inflammatory response; signal transduction