Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CRHBP rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.)

Rabbit anti-Human CRHBP Polyclonal Antibody | anti-CRHBP antibody

CRHBP (Corticotropin-releasing Hormone-binding Protein, CRH-BP, Corticotropin-Releasing Factor-binding Protein, CRF-binding Protein, CRF-BP, CRFBP) (AP)

Gene Names
CRHBP; CRFBP; CRF-BP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRHBP; Polyclonal Antibody; CRHBP (Corticotropin-releasing Hormone-binding Protein; CRH-BP; Corticotropin-Releasing Factor-binding Protein; CRF-binding Protein; CRF-BP; CRFBP) (AP); anti-CRHBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CRHBP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CRHBP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CRHBP, aa1-322 (NP_001873.2).
Immunogen Sequence
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CRHBP rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.)

Western Blot (WB) (CRHBP rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.)

Western Blot (WB)

(Western Blot analysis of CRHBP expression in transfected 293T cell line by CRHBP polyclonal antibody. Lane 1: CRHBP transfected lysate (36.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRHBP expression in transfected 293T cell line by CRHBP polyclonal antibody. Lane 1: CRHBP transfected lysate (36.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CRHBP antibody
Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein (CRHBP) which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy.
Product Categories/Family for anti-CRHBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,144 Da
NCBI Official Full Name
corticotropin-releasing factor-binding protein
NCBI Official Synonym Full Names
corticotropin releasing hormone binding protein
NCBI Official Symbol
CRHBP
NCBI Official Synonym Symbols
CRFBP; CRF-BP
NCBI Protein Information
corticotropin-releasing factor-binding protein; CRF-binding protein; CRH-BP; corticotropin releasing hormone-binding protein; corticotropin-releasing hormone-binding protein
UniProt Protein Name
Corticotropin-releasing factor-binding protein
UniProt Gene Name
CRHBP
UniProt Synonym Gene Names
CRFBP; CRF-BP; CRF-binding protein; CRH-BP
UniProt Entry Name
CRHBP_HUMAN

NCBI Description

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]

Uniprot Description

CRHBP: Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy. Belongs to the CRF-binding protein family.

Protein type: Secreted, signal peptide; Inhibitor; Secreted

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: Golgi apparatus; multivesicular body; extracellular space; microtubule; endoplasmic reticulum; dendrite; perikaryon; intracellular; nerve terminal; nucleus; secretory granule

Molecular Function: protein binding; corticotropin-releasing hormone binding; peptide binding

Biological Process: negative regulation of adrenocorticotropic hormone secretion; regulated secretory pathway; synaptic transmission, dopaminergic; learning and/or memory; hormone-mediated signaling; cellular response to stress; regulation of adrenocorticotropin hormone secretion; hormone metabolic process; female pregnancy; behavioral response to ethanol; inflammatory response; signal transduction

Research Articles on CRHBP

Similar Products

Product Notes

The CRHBP crhbp (Catalog #AAA6374720) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRHBP (Corticotropin-releasing Hormone-binding Protein, CRH-BP, Corticotropin-Releasing Factor-binding Protein, CRF-binding Protein, CRF-BP, CRFBP) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRHBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRHBP crhbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRHBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.