Rabbit anti-Human, Mouse COMT Polyclonal Antibody | anti-COMT antibody

COMT (Catechol-O-Methyltransferase) (AP)

Cat. Num. AAA6374412

• Gene Names: COMT; HEL-S-98n
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COMT; Polyclonal Antibody; COMT (Catechol-O-Methyltransferase) (AP); anti-COMT antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human COMT. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-COMT antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human COMT, aa1-221 (NP_009294.1).
• Immunogen Sequence: MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(COMT rabbit polyclonal antibody. Western Blot analysis of COMT expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of COMT expression in transfected 293T cell line by COMT polyclonal antibody. Lane 1: COMT transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-COMT antibody

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters.

Product Categories/Family for anti-COMT antibody

Antibodies; Enzymes; Methyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 6466450
• NCBI GeneID: 1312
• NCBI Accession #: NP_009294.1
• NCBI GenBank Nucleotide #: NM_007310.1
• UniProt Accession #: P21964; Q6IB07; Q6ICE6; Q9BWC7; A8MPV9
• Molecular Weight: 24,449 Da
• NCBI Official Full Name: catechol O-methyltransferase isoform S-COMT
• NCBI Official Synonym Full Names: catechol-O-methyltransferase
• NCBI Official Symbol: COMT
• NCBI Official Synonym Symbols: HEL-S-98n
• NCBI Protein Information: catechol O-methyltransferase; epididymis secretory sperm binding protein Li 98n
• UniProt Protein Name: Catechol O-methyltransferase
• Protein Family: Catechol O-methyltransferase
• UniProt Gene Name: COMT
• UniProt Entry Name: COMT_HUMAN

NCBI Description

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008]

Uniprot Description

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Methyltransferase; Membrane protein, integral; EC 2.1.1.6; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: postsynaptic membrane; mitochondrion; membrane; axon; plasma membrane; integral to membrane; dendritic spine; cytosol

Molecular Function: protein binding; magnesium ion binding; O-methyltransferase activity; catechol O-methyltransferase activity

Biological Process: response to drug; methylation; estrogen metabolic process; cellular response to phosphate starvation; neurotransmitter catabolic process; dopamine catabolic process; negative regulation of smooth muscle cell proliferation; short-term memory; response to pain; response to lipopolysaccharide; learning; female pregnancy; reproductive process in a multicellular organism; response to organic cyclic substance; positive regulation of homocysteine metabolic process; negative regulation of dopamine metabolic process; synaptic transmission; xenobiotic metabolic process; regulation of sensory perception of pain; developmental process; neurotransmitter biosynthetic process

Disease: Schizophrenia; Panic Disorder 1