Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CD74 Polyclonal Antibody | anti-CD74 antibody

CD74 (HLA Class II Histocompatibility Antigen gamma Chain, HLA-DR Antigens-associated Invariant Chain, Ia Antigen-associated Invariant Chain, Ii, p33, DHLAG) (MaxLight 650)

Gene Names
CD74; II; DHLAG; HLADG; Ia-GAMMA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD74; Polyclonal Antibody; CD74 (HLA Class II Histocompatibility Antigen gamma Chain; HLA-DR Antigens-associated Invariant Chain; Ia Antigen-associated Invariant Chain; Ii; p33; DHLAG) (MaxLight 650); anti-CD74 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD74.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CD74 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD74, aa1-160 (NP_001020329.1).
Immunogen Sequence
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CD74 antibody
CD74 is a type II transmembrane glycoprotein, also known as MHC Class II associated invariant chain, invariant chain, Ii, MHC class II chaperone, or MIF receptor. CD74 exists in 4 isoforms with the molecular sizes 33, 35, 41, and 43kD depending on genetic splicing. CD74 is primarily expressed on antigen presenting cells, including B cells, monocytes/macrophages, dendritic cells, and Langerhans cells. It is also expressed by activated T cells, activated endothelial and epithelial cells as well as the carcinomas of lung, renal, gastric and thymic origin. The primary function of CD74 is for intracellular sorting of the MHC class II molecules, regulation of loading exogenous peptides onto MHC class II. It is also involved in the modulation of B cell differentiation and positive selection of CD4+ T cells. It has been reported that CD74 binds MIF (macrophage migration inhibitory factory) and signaling through CD44 to regulate innate and adaptive immunity, and that the H. pylori infection is through urease B binding CD74 on gastric epithelial cells and inducing cell activation.
Product Categories/Family for anti-CD74 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
972
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,328 Da
NCBI Official Full Name
HLA class II histocompatibility antigen gamma chain isoform c
NCBI Official Synonym Full Names
CD74 molecule
NCBI Official Symbol
CD74
NCBI Official Synonym Symbols
II; DHLAG; HLADG; Ia-GAMMA
NCBI Protein Information
HLA class II histocompatibility antigen gamma chain
UniProt Protein Name
HLA class II histocompatibility antigen gamma chain
UniProt Gene Name
CD74
UniProt Synonym Gene Names
DHLAG; Ii
UniProt Entry Name
HG2A_HUMAN

Uniprot Description

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: lysosomal lumen; cell surface; lysosomal membrane; integral to membrane; MHC class II protein complex; Golgi membrane; multivesicular body; membrane; plasma membrane; vacuole; trans-Golgi network membrane; intracellular; external side of plasma membrane

Molecular Function: identical protein binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; beta-amyloid binding; cytokine binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding; MHC class II protein binding

Biological Process: activation of MAPK activity; positive regulation of dendritic cell antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; defense response; prostaglandin biosynthetic process; signal transduction; negative regulation of T cell differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; intracellular protein transport; positive regulation of fibroblast proliferation; negative regulation of mature B cell apoptosis; positive regulation of B cell proliferation; protein complex assembly; positive thymic T cell selection; negative regulation of peptide secretion; positive regulation of T-helper 2 type immune response; chaperone cofactor-dependent protein folding; regulation of macrophage activation; T cell selection; negative thymic T cell selection; cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; immunoglobulin mediated immune response; positive regulation of cytokine and chemokine mediated signaling pathway; antigen processing and presentation of endogenous antigen; negative regulation of apoptosis

Similar Products

Product Notes

The CD74 cd74 (Catalog #AAA6373265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD74 (HLA Class II Histocompatibility Antigen gamma Chain, HLA-DR Antigens-associated Invariant Chain, Ia Antigen-associated Invariant Chain, Ii, p33, DHLAG) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD74 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD74 cd74 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD74, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.