Rabbit anti-Human CD74 Polyclonal Antibody | anti-CD74 antibody

CD74 (HLA Class II Histocompatibility Antigen gamma Chain, HLA-DR Antigens-associated Invariant Chain, Ia Antigen-associated Invariant Chain, Ii, p33, DHLAG) (Biotin)

Cat. Num. AAA6373259

• Gene Names: CD74; II; DHLAG; HLADG; Ia-GAMMA
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD74; Polyclonal Antibody; CD74 (HLA Class II Histocompatibility Antigen gamma Chain; HLA-DR Antigens-associated Invariant Chain; Ia Antigen-associated Invariant Chain; Ii; p33; DHLAG) (Biotin); anti-CD74 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CD74.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CD74 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CD74, aa1-160 (NP_001020329.1).
• Immunogen Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD74 expression in transfected 293T cell line by CD74 polyclonal antibody. Lane 1: CD74 transfected lysate (18.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with CD74 rabbit purified polyclonal 1:1200 and HLA-DQA1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-CD74 antibody

CD74 is a type II transmembrane glycoprotein, also known as MHC Class II associated invariant chain, invariant chain, Ii, MHC class II chaperone, or MIF receptor. CD74 exists in 4 isoforms with the molecular sizes 33, 35, 41, and 43kD depending on genetic splicing. CD74 is primarily expressed on antigen presenting cells, including B cells, monocytes/macrophages, dendritic cells, and Langerhans cells. It is also expressed by activated T cells, activated endothelial and epithelial cells as well as the carcinomas of lung, renal, gastric and thymic origin. The primary function of CD74 is for intracellular sorting of the MHC class II molecules, regulation of loading exogenous peptides onto MHC class II. It is also involved in the modulation of B cell differentiation and positive selection of CD4+ T cells. It has been reported that CD74 binds MIF (macrophage migration inhibitory factory) and signaling through CD44 to regulate innate and adaptive immunity, and that the H. pylori infection is through urease B binding CD74 on gastric epithelial cells and inducing cell activation.

Product Categories/Family for anti-CD74 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 68448537
• NCBI GeneID: 972
• NCBI Accession #: NP_001020329.1
• NCBI GenBank Nucleotide #: NM_001025158.1
• UniProt Accession #: P04233; Q14597; Q29832; Q5U0J8; Q8SNA0; Q8WLP6; A8K7R1; B4DNE8; D3DQG3; D3DQG4
• Molecular Weight: 18,328 Da
• NCBI Official Full Name: HLA class II histocompatibility antigen gamma chain isoform c
• NCBI Official Synonym Full Names: CD74 molecule
• NCBI Official Symbol: CD74
• NCBI Official Synonym Symbols: II; DHLAG; HLADG; Ia-GAMMA
• NCBI Protein Information: HLA class II histocompatibility antigen gamma chain
• UniProt Protein Name: HLA class II histocompatibility antigen gamma chain
• Protein Family: H-2 class II histocompatibility antigen
• UniProt Gene Name: CD74
• UniProt Synonym Gene Names: DHLAG; Ii
• UniProt Entry Name: HG2A_HUMAN

Uniprot Description

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: lysosomal lumen; cell surface; lysosomal membrane; integral to membrane; MHC class II protein complex; Golgi membrane; multivesicular body; membrane; plasma membrane; vacuole; trans-Golgi network membrane; intracellular; external side of plasma membrane

Molecular Function: identical protein binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; beta-amyloid binding; cytokine binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding; MHC class II protein binding

Biological Process: activation of MAPK activity; positive regulation of dendritic cell antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; defense response; prostaglandin biosynthetic process; signal transduction; negative regulation of T cell differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; intracellular protein transport; positive regulation of fibroblast proliferation; negative regulation of mature B cell apoptosis; positive regulation of B cell proliferation; protein complex assembly; positive thymic T cell selection; negative regulation of peptide secretion; positive regulation of T-helper 2 type immune response; chaperone cofactor-dependent protein folding; regulation of macrophage activation; T cell selection; negative thymic T cell selection; cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; immunoglobulin mediated immune response; positive regulation of cytokine and chemokine mediated signaling pathway; antigen processing and presentation of endogenous antigen; negative regulation of apoptosis