Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATP5H expression in transfected 293T cell line by ATP5H polyclonal antibody. Lane 1: ATP5H transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ATP5H Polyclonal Antibody | anti-ATP5H antibody

ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) (PE)

Gene Names
ATP5PD; ATPQ; APT5H; ATP5H
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP5H; Polyclonal Antibody; ATP5H (ATP Synthase Subunit D; Mitochondrial; ATPase Subunit D; My032) (PE); anti-ATP5H antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATP5H.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
609
Applicable Applications for anti-ATP5H antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human ATP5H, aa1-161 (NP_006347.1).
Immunogen Sequence
MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP5H expression in transfected 293T cell line by ATP5H polyclonal antibody. Lane 1: ATP5H transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP5H expression in transfected 293T cell line by ATP5H polyclonal antibody. Lane 1: ATP5H transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATP5H antibody
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1)-containing the extramembraneous catalytic core, and F(0)-containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
Product Categories/Family for anti-ATP5H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ATP synthase peripheral stalk subunit d (ATP5PD), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ATP synthase peripheral stalk subunit d
NCBI Official Symbol
ATP5PD
NCBI Official Synonym Symbols
ATPQ; APT5H; ATP5H
NCBI Protein Information
ATP synthase subunit d, mitochondrial
UniProt Protein Name
ATP synthase subunit d, mitochondrial
UniProt Gene Name
ATP5H
UniProt Synonym Gene Names
ATPase subunit d
UniProt Entry Name
ATP5H_HUMAN

NCBI Description

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010]

Uniprot Description

ATP5H: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Belongs to the ATPase d subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.3.14; Mitochondrial; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: nucleoplasm; mitochondrion; mitochondrial inner membrane; cytoplasm; mitochondrial proton-transporting ATP synthase complex

Molecular Function: ATPase activity; hydrogen ion transmembrane transporter activity; transmembrane transporter activity

Biological Process: cellular metabolic process; mitochondrial ATP synthesis coupled proton transport

Research Articles on ATP5H

Similar Products

Product Notes

The ATP5H atp5h (Catalog #AAA6370715) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5H can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP5H atp5h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP5H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.