Rabbit anti-Human ATP5H Polyclonal Antibody | anti-ATP5H antibody

ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) (Biotin)

Cat. Num. AAA6370707

• Gene Names: ATP5PD; ATPQ; APT5H; ATP5H
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP5H; Polyclonal Antibody; ATP5H (ATP Synthase Subunit D; Mitochondrial; ATPase Subunit D; My032) (Biotin); anti-ATP5H antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ATP5H.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 609

• Applicable Applications for anti-ATP5H antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human ATP5H, aa1-161 (NP_006347.1).
• Immunogen Sequence: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP5H expression in transfected 293T cell line by ATP5H polyclonal antibody. Lane 1: ATP5H transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ATP5H antibody

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1)-containing the extramembraneous catalytic core, and F(0)-containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.

Product Categories/Family for anti-ATP5H antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 1519245926
• NCBI GeneID: 10476
• NCBI Accession #: NM_006356.3
• NCBI GenBank Nucleotide #: NM_006356
• UniProt Accession #: O75947
• NCBI Official Full Name: Homo sapiens ATP synthase peripheral stalk subunit d (ATP5PD), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: ATP synthase peripheral stalk subunit d
• NCBI Official Symbol: ATP5PD
• NCBI Official Synonym Symbols: ATPQ; APT5H; ATP5H
• NCBI Protein Information: ATP synthase subunit d, mitochondrial
• UniProt Protein Name: ATP synthase subunit d, mitochondrial
• UniProt Gene Name: ATP5H
• UniProt Synonym Gene Names: ATPase subunit d
• UniProt Entry Name: ATP5H_HUMAN

NCBI Description

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010]

Uniprot Description

ATP5H: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Belongs to the ATPase d subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.3.14; Mitochondrial; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: nucleoplasm; mitochondrion; mitochondrial inner membrane; cytoplasm; mitochondrial proton-transporting ATP synthase complex

Molecular Function: ATPase activity; hydrogen ion transmembrane transporter activity; transmembrane transporter activity

Biological Process: cellular metabolic process; mitochondrial ATP synthesis coupled proton transport