Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (APRT rabbit polyclonal antibody. Western Blot analysis of APRT expression in K-562.)

Rabbit anti-Human APRT Polyclonal Antibody | anti-APRT antibody

APRT (Adenine Phosphoribosyltransferase) APC

Gene Names
APRT; AMP; APRTD
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APRT; Polyclonal Antibody; APRT (Adenine Phosphoribosyltransferase) APC; anti-APRT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human APRT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-APRT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human APRT, aa1-180 (NP_000476.1).
Immunogen Sequence
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(APRT rabbit polyclonal antibody. Western Blot analysis of APRT expression in K-562.)

Western Blot (WB) (APRT rabbit polyclonal antibody. Western Blot analysis of APRT expression in K-562.)

Western Blot (WB)

(Western Blot analysis of APRT expression in transfected 293T cell line by APRT polyclonal antibody. Lane 1: APRT transfected lysate (19.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of APRT expression in transfected 293T cell line by APRT polyclonal antibody. Lane 1: APRT transfected lysate (19.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-APRT antibody
A conserved feature of APRT is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.
Product Categories/Family for anti-APRT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
353
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
adenine phosphoribosyltransferase isoform a
NCBI Official Synonym Full Names
adenine phosphoribosyltransferase
NCBI Official Symbol
APRT
NCBI Official Synonym Symbols
AMP; APRTD
NCBI Protein Information
adenine phosphoribosyltransferase; AMP diphosphorylase; AMP pyrophosphorylase; transphosphoribosidase
UniProt Protein Name
Adenine phosphoribosyltransferase
UniProt Gene Name
APRT
UniProt Synonym Gene Names
APRT
UniProt Entry Name
APT_HUMAN

NCBI Description

Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

APRT: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. Defects in APRT are the cause of adenine phosphoribosyltransferase deficiency (APRTD); also known as 2,8-dihydroxyadenine urolithiasis. An enzymatic deficiency that can lead to urolithiasis and renal failure. Patients have 2,8-dihydroxyadenine (DHA) urinary stones. Belongs to the purine/pyrimidine phosphoribosyltransferase family.

Protein type: EC 2.4.2.7; Transferase; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 16q24

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: adenine binding; adenine phosphoribosyltransferase activity; AMP binding

Biological Process: lactation; grooming behavior; cellular response to insulin stimulus; nucleobase, nucleoside and nucleotide metabolic process; adenine salvage; purine salvage; purine base metabolic process

Disease: Adenine Phosphoribosyltransferase Deficiency

Research Articles on APRT

Similar Products

Product Notes

The APRT aprt (Catalog #AAA6370189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APRT (Adenine Phosphoribosyltransferase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APRT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APRT aprt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APRT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.