Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human AKR1C3 Polyclonal Antibody | anti-AKR1C3 antibody

AKR1C3 (DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto Reductase Family 1 Member C3, 17-beta-hydroxysteroid Dehydrogenase Type 5, 3-alpha-HSD Type II, Brain, 3-alpha-hydroxysteroid Dehydrogenase Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydroge

Gene Names
AKR1C3; DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKR1C3; Polyclonal Antibody; AKR1C3 (DDH1; HSD17B5; KIAA0119; PGFS; Aldo-keto Reductase Family 1 Member C3; 17-beta-hydroxysteroid Dehydrogenase Type 5; 3-alpha-HSD Type II; Brain; 3-alpha-hydroxysteroid Dehydrogenase Type 2; Chlordecone Reductase Homolog HAKRb; Dihydrodiol Dehydroge; anti-AKR1C3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AKR1C3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-AKR1C3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AKR1C3, aa1-323 (NP_003730.4).
Immunogen Sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AKR1C3 antibody
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Product Categories/Family for anti-AKR1C3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,853 Da
NCBI Official Full Name
aldo-keto reductase family 1 member C3 isoform 1
NCBI Official Synonym Full Names
aldo-keto reductase family 1, member C3
NCBI Official Symbol
AKR1C3
NCBI Official Synonym Symbols
DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS
NCBI Protein Information
aldo-keto reductase family 1 member C3; indanol dehydrogenase; prostaglandin F synthase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; dihydrodiol dehydrogenase X; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; 3-alp
UniProt Protein Name
Aldo-keto reductase family 1 member C3
UniProt Gene Name
AKR1C3
UniProt Synonym Gene Names
DDH1; HSD17B5; KIAA0119; PGFS; 17-beta-HSD 5; 3-alpha-HSD type 2; DD-3; DD3; PGFS
UniProt Entry Name
AK1C3_HUMAN

Uniprot Description

AKR1C3: Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta- PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone. Belongs to the aldo/keto reductase family.

Protein type: Lipid Metabolism - arachidonic acid; Oxidoreductase; EC 1.1.1.149; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 10p15-p14

Cellular Component: cytoplasm; intracellular; nucleus; cytosol

Molecular Function: 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity; delta4-3-oxosteroid 5beta-reductase activity; aldo-keto reductase activity; prostaglandin-F synthase activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity; 3(or 17)-alpha-hydroxysteroid dehydrogenase activity; retinol dehydrogenase activity; phenanthrene 9,10-monooxygenase activity; oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; testosterone 17-beta-dehydrogenase (NADP+) activity; ketosteroid monooxygenase activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity; ketoreductase activity; indanol dehydrogenase activity; aldehyde reductase activity; geranylgeranyl reductase activity; retinal dehydrogenase activity

Biological Process: steroid metabolic process; phototransduction, visible light; retinal metabolic process; cyclooxygenase pathway; male gonad development; progesterone metabolic process; cellular response to starvation; prostaglandin metabolic process; keratinocyte differentiation; G-protein coupled receptor protein signaling pathway; positive regulation of protein kinase B signaling cascade; protein import into nucleus, translocation; positive regulation of cell proliferation; arachidonic acid metabolic process; multicellular organismal macromolecule metabolic process; farnesol catabolic process; retinoid metabolic process; regulation of retinoic acid receptor signaling pathway; response to nutrient

Similar Products

Product Notes

The AKR1C3 akr1c3 (Catalog #AAA6369338) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1C3 (DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto Reductase Family 1 Member C3, 17-beta-hydroxysteroid Dehydrogenase Type 5, 3-alpha-HSD Type II, Brain, 3-alpha-hydroxysteroid Dehydrogenase Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydroge reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1C3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1C3 akr1c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1C3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.