Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AKR1C2 rabbit polyclonal antibody. Western Blot analysis of AKR1C2 expression in human liver.)

Rabbit anti-Human AKR1C2 Polyclonal Antibody | anti-AKR1C2 antibody

AKR1C2 (Aldo-keto Reductase Family 1 Member C2, 3-alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-binding Protein, DD/BABP, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, Type

Gene Names
AKR1C2; DD; DD2; TDD; BABP; DD-2; DDH2; HBAB; HAKRD; MCDR2; SRXY8; DD/BABP; AKR1C-pseudo
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKR1C2; Polyclonal Antibody; AKR1C2 (Aldo-keto Reductase Family 1 Member C2; 3-alpha-HSD3; Chlordecone Reductase Homolog HAKRD; Dihydrodiol Dehydrogenase 2; DD-2; DD2; Dihydrodiol Dehydrogenase/Bile Acid-binding Protein; DD/BABP; Trans-1; 2-dihydrobenzene-1; 2-diol Dehydrogenase; Type; anti-AKR1C2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AKR1C2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
323
Applicable Applications for anti-AKR1C2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AKR1C2, aa1-323 (AAH07024.1).
Immunogen Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AKR1C2 rabbit polyclonal antibody. Western Blot analysis of AKR1C2 expression in human liver.)

Western Blot (WB) (AKR1C2 rabbit polyclonal antibody. Western Blot analysis of AKR1C2 expression in human liver.)

Western Blot (WB)

(AKR1C2 rabbit polyclonal antibody. Western Blot analysis of AKR1C2 expression in HeLa.)

Western Blot (WB) (AKR1C2 rabbit polyclonal antibody. Western Blot analysis of AKR1C2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of AKR1C2 expression in transfected 293T cell line by AKR1C2 polyclonal antibody. Lane 1: AKR1C2 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AKR1C2 expression in transfected 293T cell line by AKR1C2 polyclonal antibody. Lane 1: AKR1C2 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AKR1C2 antibody
AKR1C2 is a member of the aldo-oxo reductase (AKR) superfamily. It catalyzes the NADP-linked oxidation of trans-dihydrodiols of aromatic hydrocarbons to corresponding catechols. AKR1C2 works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. It catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). AKR1C2 has a high bile-binding ability.
Product Categories/Family for anti-AKR1C2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member C2
NCBI Official Symbol
AKR1C2
NCBI Official Synonym Symbols
DD; DD2; TDD; BABP; DD-2; DDH2; HBAB; HAKRD; MCDR2; SRXY8; DD/BABP; AKR1C-pseudo
NCBI Protein Information
aldo-keto reductase family 1 member C2

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Research Articles on AKR1C2

Similar Products

Product Notes

The AKR1C2 (Catalog #AAA6369323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1C2 (Aldo-keto Reductase Family 1 Member C2, 3-alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-binding Protein, DD/BABP, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, Type reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1C2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1C2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1C2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.