Mouse SLC11A2 Monoclonal Antibody | anti-SLC11A2 antibody

SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2, DCT1, DMT1, FLJ37416, NRAMP2) (MaxLight 750)

Cat. Num. AAA6240554

• Gene Names: SLC11A2; DCT1; DMT1; AHMIO1; NRAMP2
• Applications: Western Blot
• Purity: Purified
• Synonyms: SLC11A2; Monoclonal Antibody; SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters); Member 2; DCT1; DMT1; FLJ37416; NRAMP2) (MaxLight 750); Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters); NRAMP2; anti-SLC11A2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F7
• Specificity: Recognizes SLC11A2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-SLC11A2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SLC11A2 (NP_000608, 1aa-65aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SLC11A2 antibody

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]). [supplied by OMIM].

Product Categories/Family for anti-SLC11A2 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 10835169
• NCBI GeneID: 4891
• NCBI Accession #: NP_000608
• NCBI GenBank Nucleotide #: NM_000617
• UniProt Accession #: P49281
• Molecular Weight: 61kDa
• NCBI Official Full Name: natural resistance-associated macrophage protein 2 isoform 3
• NCBI Official Synonym Full Names: solute carrier family 11 member 2
• NCBI Official Symbol: SLC11A2
• NCBI Official Synonym Symbols: DCT1; DMT1; AHMIO1; NRAMP2
• NCBI Protein Information: natural resistance-associated macrophage protein 2
• UniProt Protein Name: Natural resistance-associated macrophage protein 2
• Protein Family: Natural resistance-associated macrophage protein
• UniProt Gene Name: SLC11A2
• UniProt Synonym Gene Names: DCT1; DMT1; NRAMP2; NRAMP 2; DMT-1
• UniProt Entry Name: NRAM2_HUMAN

NCBI Description

This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Apr 2010]

Uniprot Description

SLC11A2: Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. Defects in SLC11A2 are a cause of hypochromic microcytic anemia (HCMA). The disease is characterized by an abnormal hemoglobin content in the erythrocytes which are reduced in size. It may be hereditary or acquired. Mutations in SLC11A2 are associated with progressive liver iron overload and normal to moderately elevated serum ferritin levels. Belongs to the NRAMP family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cell surface; integral to plasma membrane; late endosome membrane; lysosomal membrane; lysosome; early endosome; trans-Golgi network; mitochondrial outer membrane; recycling endosome; membrane; perinuclear region of cytoplasm; apical part of cell; cytoplasm; apical plasma membrane; late endosome; plasma membrane; vacuole; cytoplasmic vesicle; nucleus; brush border

Molecular Function: cadmium ion transmembrane transporter activity; nickel ion transmembrane transporter activity; inorganic cation transmembrane transporter activity; zinc ion binding; hydrogen ion transmembrane transporter activity; manganese ion transmembrane transporter activity; cadmium ion binding; vanadium ion transmembrane transporter activity; nickel ion binding; copper ion transmembrane transporter activity; protein binding; copper ion binding; manganese ion binding; iron ion binding; calcium ion transmembrane transporter activity; zinc ion transmembrane transporter activity; cobalt ion transmembrane transporter activity; lead ion transmembrane transporter activity; ferrous iron transmembrane transporter activity; cobalt ion binding; solute:hydrogen symporter activity

Biological Process: caspase activation; lead ion transport; erythrocyte development; cellular copper ion homeostasis; cellular iron ion homeostasis; dendrite morphogenesis; manganese ion transport; copper ion transport; response to manganese ion; nickel ion transport; response to cadmium ion; learning and/or memory; vanadium ion transport; detection of oxygen; ferrous iron transport; response to lead ion; response to hypoxia; transmembrane transport; response to iron ion; cobalt ion transport; heme biosynthetic process

Disease: Anemia, Hypochromic Microcytic, With Iron Overload 1