Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse SH3MD2 Monoclonal Antibody | anti-SH3MD2 antibody

SH3MD2 (SH3 Domain Containing Ring Finger 1, FLJ21602, KIAA1494, POSH, RNF142, SH3MD2) (MaxLight 750)

Gene Names
SH3RF1; POSH; RNF142; SH3MD2
Applications
Western Blot
Purity
Purified
Synonyms
SH3MD2; Monoclonal Antibody; SH3MD2 (SH3 Domain Containing Ring Finger 1; FLJ21602; KIAA1494; POSH; RNF142; SH3MD2) (MaxLight 750); SH3 Domain Containing Ring Finger 1; anti-SH3MD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F7
Specificity
Recognizes SH3MD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-SH3MD2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SH3MD2 (NP_065921, 790aa-888aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SH3MD2 antibody
This gene encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module. [provided by RefSeq]
Product Categories/Family for anti-SH3MD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,108 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase SH3RF1
NCBI Official Synonym Full Names
SH3 domain containing ring finger 1
NCBI Official Symbol
SH3RF1
NCBI Official Synonym Symbols
POSH; RNF142; SH3MD2
NCBI Protein Information
E3 ubiquitin-protein ligase SH3RF1; SH3 domain-containing RING finger protein 1; SH3 multiple domains 2; SH3 multiple domains protein 2; plenty of SH3 domains; plenty of SH3s; putative E3 ubiquitin-protein ligase SH3RF1; ring finger protein 142
UniProt Protein Name
E3 ubiquitin-protein ligase SH3RF1
UniProt Gene Name
SH3RF1
UniProt Synonym Gene Names
KIAA1494; POSH; RNF142; SH3MD2; Protein POSH
UniProt Entry Name
SH3R1_HUMAN

Similar Products

Product Notes

The SH3MD2 sh3rf1 (Catalog #AAA6240535) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SH3MD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH3MD2 sh3rf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH3MD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.