Mouse anti-Human, Rat SH3MD2 Monoclonal Antibody | anti-SH3MD2 antibody

SH3MD2 (SH3RF1, Putative E3 Ubiquitin-protein Ligase SH3RF1, SH3 Domain-containing RING Finger Protein 1, Plenty of SH3s, Protein POSH, SH3 Multiple Domains Protein 2, RING Finger Protein 142, KIAA1494, POSH, RNF142) APC

Cat. Num. AAA6139039

• Gene Names: SH3RF1; POSH; RNF142; SH3MD2
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SH3MD2; Monoclonal Antibody; SH3MD2 (SH3RF1; Putative E3 Ubiquitin-protein Ligase SH3RF1; SH3 Domain-containing RING Finger Protein 1; Plenty of SH3s; Protein POSH; SH3 Multiple Domains Protein 2; RING Finger Protein 142; KIAA1494; POSH; RNF142) APC; anti-SH3MD2 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H3
• Specificity: Recognizes human SH3MD2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SH3MD2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa790-889 from human SH3MD2 (NP_065921) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(SH3MD2 monoclonal antibody, Western Blot analysis of SH3MD2 expression in HeLa.)

Western Blot (WB)

(SH3MD2 monoclonal antibody. Western Blot analysis of SH3MD2 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged SH3MD2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-SH3MD2 antibody

This gene encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module. [provided by RefSeq]

Product Categories/Family for anti-SH3MD2 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 51988887
• NCBI GeneID: 57630
• NCBI Accession #: NP_065921
• NCBI GenBank Nucleotide #: NM_020870
• UniProt Accession #: Q7Z6J0; Q05BT2; Q8IW46; Q9HAM2; Q9P234
• Molecular Weight: 48,108 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase SH3RF1
• NCBI Official Synonym Full Names: SH3 domain containing ring finger 1
• NCBI Official Symbol: SH3RF1
• NCBI Official Synonym Symbols: POSH; RNF142; SH3MD2
• NCBI Protein Information: E3 ubiquitin-protein ligase SH3RF1; SH3 domain-containing RING finger protein 1; SH3 multiple domains 2; SH3 multiple domains protein 2; plenty of SH3 domains; plenty of SH3s; putative E3 ubiquitin-protein ligase SH3RF1; ring finger protein 142
• UniProt Protein Name: E3 ubiquitin-protein ligase SH3RF1
• UniProt Gene Name: SH3RF1
• UniProt Synonym Gene Names: KIAA1494; POSH; RNF142; SH3MD2; Protein POSH
• UniProt Entry Name: SH3R1_HUMAN