Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RARRES3 Monoclonal Antibody | anti-RARRES3 antibody

RARRES3 (Retinoic Acid Receptor Responder Protein 3, RAR-responsive Protein TIG3, Retinoid-inducible Gene 1 Protein, Tazarotene-induced Gene 3 Protein, RIG1, TIG3, MGC8906) (MaxLight 750)

Gene Names
RARRES3; RIG1; TIG3; HRSL4; HRASLS4; PLA1/2-3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RARRES3; Monoclonal Antibody; RARRES3 (Retinoic Acid Receptor Responder Protein 3; RAR-responsive Protein TIG3; Retinoid-inducible Gene 1 Protein; Tazarotene-induced Gene 3 Protein; RIG1; TIG3; MGC8906) (MaxLight 750); anti-RARRES3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H5
Specificity
Recognizes human RARRES3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-RARRES3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RARRES3, aa1-165 (AAH09678) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RARRES3 antibody
RARRES3 also called Tig3 or RIG1 is an 18kD, 164aa cytoplasmic protein within the LRAT family of growth inhibitory proteins, which are class II tumor-suppressors. RARRES3 is expressed in a variety of cells including epidermal keratinocytes, and may be downregulated in tumor cells and cell lines. It shows phospholipase activity and interaction with type I transglutaminase. A C-terminal hydrophobic region allows perinuclear localization. RARRES3 is not structurally related to other RARRES genes. A canine ortholog shares 72% aa identity within the region used as an immunogen; orthologs are unlikely in rodents.
Product Categories/Family for anti-RARRES3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,436 Da
NCBI Official Full Name
Homo sapiens retinoic acid receptor responder (tazarotene induced) 3, mRNA
NCBI Official Synonym Full Names
retinoic acid receptor responder 3
NCBI Official Symbol
RARRES3
NCBI Official Synonym Symbols
RIG1; TIG3; HRSL4; HRASLS4; PLA1/2-3
NCBI Protein Information
retinoic acid receptor responder protein 3

NCBI Description

Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator. [provided by RefSeq, Jul 2008]

Research Articles on RARRES3

Similar Products

Product Notes

The RARRES3 (Catalog #AAA6234887) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RARRES3 (Retinoic Acid Receptor Responder Protein 3, RAR-responsive Protein TIG3, Retinoid-inducible Gene 1 Protein, Tazarotene-induced Gene 3 Protein, RIG1, TIG3, MGC8906) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RARRES3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RARRES3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RARRES3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.