Western Blot (WB)
(Western blot analysis of CNPase expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). CNPase at 47KD was detected using rabbit anti- CNPase Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Rabbit CNPase Polyclonal Antibody | anti-CNP antibody
Anti-CNPase Antibody
Gene Names
CNP; CNP1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
CNPase; Polyclonal Antibody; Anti-CNPase Antibody; CNP 1; CNP1; CNP; P09543; 2'; 3'-cyclic-nucleotide 3'-phosphodiesterase; anti-CNP antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
401
Applicable Applications for anti-CNP antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Western blot analysis of CNPase expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). CNPase at 47KD was detected using rabbit anti- CNPase Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Western Blot (WB)
(Western blot analysis of CNPase expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). CNPase at 47KD was detected using rabbit anti- CNPase Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CNP antibody
Rabbit IgG polyclonal antibody for 2', 3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection.
Background: 2', 3'-Cyclic-nucleotide 3'-phosphodiesterase, also known as CNPase, is an enzyme that in humans is encoded by the CNP gene. And this gene is mapped to 17q21.2. CNPase is named for its ability to catalyze the phosphodiester hydrolysis of 2', 3'-cyclic nucleotides to 2'-nucleotides. CNPase is thought to play a critical role in the events leading up to myelination. Additionally, CNPase has been demonstrated to inhibit the replication of HIV-1 and other primate lentiviruses by binding the retroviral Gag protein and inhibiting the genesis of nascent viral particles.
Background: 2', 3'-Cyclic-nucleotide 3'-phosphodiesterase, also known as CNPase, is an enzyme that in humans is encoded by the CNP gene. And this gene is mapped to 17q21.2. CNPase is named for its ability to catalyze the phosphodiester hydrolysis of 2', 3'-cyclic nucleotides to 2'-nucleotides. CNPase is thought to play a critical role in the events leading up to myelination. Additionally, CNPase has been demonstrated to inhibit the replication of HIV-1 and other primate lentiviruses by binding the retroviral Gag protein and inhibiting the genesis of nascent viral particles.
References
1. "Entrez Gene: CNP 2', 3'-cyclic nucleotide 3' phosphodiesterase".
2. Hinman JD, Chen CD, Oh SY, Hollander W, Abraham CR (Jan 2008). "Age-dependent accumulation of ubiquitinated 2', 3'-cyclic nucleotide 3'-phosphodiesterase in myelin lipid rafts". Glia. 56 (1): 118-33.
3. Sprinkle TJ, Lanclos KD, Lapp DF (Jul 1992). "Assignment of the human 2', 3'-cyclic nucleotide 3'-phosphohydrolase gene to chromosome 17".Genomics. 13 (3): 877-80.
2. Hinman JD, Chen CD, Oh SY, Hollander W, Abraham CR (Jan 2008). "Age-dependent accumulation of ubiquitinated 2', 3'-cyclic nucleotide 3'-phosphodiesterase in myelin lipid rafts". Glia. 56 (1): 118-33.
3. Sprinkle TJ, Lanclos KD, Lapp DF (Jul 1992). "Assignment of the human 2', 3'-cyclic nucleotide 3'-phosphohydrolase gene to chromosome 17".Genomics. 13 (3): 877-80.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,099 Da
NCBI Official Full Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase isoform 2
NCBI Official Synonym Full Names
2',3'-cyclic nucleotide 3' phosphodiesterase
NCBI Official Symbol
CNP
NCBI Official Synonym Symbols
CNP1
NCBI Protein Information
2',3'-cyclic-nucleotide 3'-phosphodiesterase
UniProt Protein Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase
Protein Family
UniProt Gene Name
CNP
UniProt Synonym Gene Names
CNP; CNPase
Uniprot Description
CNP: May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin. Exists as monomers and homodimers. Belongs to the cyclic nucleotide phosphodiesterase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell development/differentiation; EC 3.1.4.37; Phosphodiesterase
Chromosomal Location of Human Ortholog: 17q21.2
Cellular Component: cytoplasm; extracellular space; membrane; nucleoplasm; nucleus
Biological Process: substantia nigra development; synaptic transmission
Research Articles on CNP
Similar Products
Product Notes
The CNP cnp (Catalog #AAA178629) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CNPase Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNPase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CNP cnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNPase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
