Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PRMT3 Monoclonal Antibody | anti-PRMT3 antibody

PRMT3 (Protein Arginine N-Methyltransferase 3, Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3, HRMT1L3) (MaxLight 750)

Gene Names
PRMT3; HRMT1L3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRMT3; Monoclonal Antibody; PRMT3 (Protein Arginine N-Methyltransferase 3; Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3; HRMT1L3) (MaxLight 750); anti-PRMT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G4
Specificity
Recognizes human PRMT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-PRMT3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-139 from PRMT3 (NP_005779) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PRMT3 antibody
Arginine methylation is an irreversible post translational modification which has only recently been linked to protein activity. At least three types of PRMT enzymes have been identified in mammalian cells. These enzymes have been shown to have essential regulatory functions by methylation of key proteins in several fundamental areas. These protein include nuclear proteins, IL enhancer binding factor, nuclear factors, cell cycle proteins, signal transduction proteins, apoptosis proteins, and viral proteins. The mammalian PRMT family currently consists of 7 members that share two large domains of homology. Outside of these domains, epitopes were identified and antibodies against all 7 PRMT members have been developed.
Product Categories/Family for anti-PRMT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62.3kDa (554aa)
NCBI Official Full Name
protein arginine N-methyltransferase 3 isoform 1
NCBI Official Synonym Full Names
protein arginine methyltransferase 3
NCBI Official Symbol
PRMT3
NCBI Official Synonym Symbols
HRMT1L3
NCBI Protein Information
protein arginine N-methyltransferase 3
UniProt Protein Name
Protein arginine N-methyltransferase 3
UniProt Gene Name
PRMT3
UniProt Synonym Gene Names
HRMT1L3
UniProt Entry Name
ANM3_HUMAN

NCBI Description

This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

PRMT3: Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins. Belongs to the protein arginine N-methyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; EC 2.1.1.-; Methyltransferase; Methyltransferase, protein arginine

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: cytosol

Molecular Function: histone-arginine N-methyltransferase activity; methyltransferase activity; protein binding; protein-arginine omega-N asymmetric methyltransferase activity

Biological Process: negative regulation of protein ubiquitination; regulation of transcription, DNA-dependent

Research Articles on PRMT3

Similar Products

Product Notes

The PRMT3 prmt3 (Catalog #AAA6234710) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRMT3 (Protein Arginine N-Methyltransferase 3, Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3, HRMT1L3) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRMT3 prmt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRMT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.