Mouse anti-Human PRMT3 Monoclonal Antibody | anti-PRMT3 antibody

PRMT3 (Protein Arginine N-Methyltransferase 3, Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3, HRMT1L3)

Cat. Num. AAA6013284

• Gene Names: PRMT3; HRMT1L3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PRMT3; Monoclonal Antibody; PRMT3 (Protein Arginine N-Methyltransferase 3; Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3; HRMT1L3); Anti -PRMT3 (Protein Arginine N-Methyltransferase 3; anti-PRMT3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G4
• Specificity: Recognizes human PRMT3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY

• Applicable Applications for anti-PRMT3 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa41-139 from PRMT3 (NP_005779) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(PRMT3 monoclonal antibody Western Blot analysis of PRMT3 expression in HepG2)

Testing Data

(Detection limit for recombinant GST tagged PRMT3 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-PRMT3 antibody

Arginine methylation is an irreversible post translational modification which has only recently been linked to protein activity. At least three types of PRMT enzymes have been identified in mammalian cells. These enzymes have been shown to have essential regulatory functions by methylation of key proteins in several fundamental areas. These protein include nuclear proteins, IL enhancer binding factor, nuclear factors, cell cycle proteins, signal transduction proteins, apoptosis proteins, and viral proteins. The mammalian PRMT family currently consists of 7 members that share two large domains of homology. Outside of these domains, epitopes were identified and antibodies against all 7 PRMT members have been developed.

Product Categories/Family for anti-PRMT3 antibody

Antibodies; Abs to Methyltransferases

NCBI and Uniprot Product Information

• NCBI GI #: 223556010
• NCBI GeneID: 10196
• NCBI Accession #: NP_001138639.1
• NCBI GenBank Nucleotide #: NM_001145167.1
• UniProt Accession #: O60678; B4DUC7
• Molecular Weight: 59,876 Da
• NCBI Official Full Name: protein arginine N-methyltransferase 3 isoform 3
• NCBI Official Synonym Full Names: protein arginine methyltransferase 3
• NCBI Official Symbol: PRMT3
• NCBI Official Synonym Symbols: HRMT1L3
• NCBI Protein Information: protein arginine N-methyltransferase 3; HMT1 hnRNP methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3
• UniProt Protein Name: Protein arginine N-methyltransferase 3
• Protein Family: Protein arginine N-methyltransferase
• UniProt Gene Name: PRMT3
• UniProt Synonym Gene Names: HRMT1L3
• UniProt Entry Name: ANM3_HUMAN

NCBI Description

This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

PRMT3: Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins. Belongs to the protein arginine N-methyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.-; Methyltransferase; Methyltransferase, protein arginine; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: cytoplasm; ribosome; cytosol

Molecular Function: methyltransferase activity; protein-arginine omega-N asymmetric methyltransferase activity; protein binding; protein-arginine N-methyltransferase activity; metal ion binding; histone-arginine N-methyltransferase activity

Biological Process: regulation of transcription, DNA-dependent; negative regulation of protein ubiquitination; peptidyl-arginine methylation, to asymmetrical-dimethyl arginine