Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Nkx 2.5 Monoclonal Antibody | anti-NKX2.5 antibody

Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (MaxLight 750)

Gene Names
NKX2-5; CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Nkx 2.5; Monoclonal Antibody; Nkx 2.5 (Homeobox Protein Nkx-2.5; Cardiac-specific; CSX; NK-2 Homolog E; NKX2.5; NKX2E; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536) (MaxLight 750); anti-NKX2.5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E4-G5
Specificity
Recognizes human NKX2-5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-NKX2.5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-324 from human NKX2-5 (AAH25711) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NKX2.5 antibody
NKX2.5 is a member of the NKX homeobox transcription factor family. NKX2.5 plays an essential role in heart development and is among the earliest factors expressed in cardiac lineage of developing embryos. Its targeted disruption in mice causes abnormal heart morphogenesis, severe growth retardation, and embryonic lethality around E9.5. Defects in NKX2.5 is associated with several forms of congenital heart diseases, such as atrial defect with atrioventricular conduction defects (ASD-AVCD) and tetralogy of Fallot (TOF). Transcription activation of NKX2.5 is also associated with certain B and T cell leukemias resultant from chromosomal translocation.
Product Categories/Family for anti-NKX2.5 antibody
References
1. Complex SUMO-1 Regulation of Cardiac Transcription Factor Nkx2-5. Costa MW, Lee S, Furtado MB, Xin L, Sparrow DB, Martinez CG, Dunwoodie SL, Kurtenbach E, Mohun T, Rosenthal N, Harvey RP.PLoS One. 2011;6(9):e24812. Epub 2011 Sep 12. 2. RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression. Yadava RS, Frenzel-McCardell CD, Yu Q, Srinivasan V, Tucker AL, Puymirat J, Thornton CA, Prall OW, Harvey RP, Mahadevan MS.Nat Genet. 2008 Jan;40(1):61-8. Epub 2007 Dec 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
11,681 Da
NCBI Official Full Name
Homo sapiens NK2 transcription factor related, locus 5 (Drosophila), mRNA
NCBI Official Synonym Full Names
NK2 homeobox 5
NCBI Official Symbol
NKX2-5
NCBI Official Synonym Symbols
CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
NCBI Protein Information
homeobox protein Nkx-2.5

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Research Articles on NKX2.5

Similar Products

Product Notes

The NKX2.5 (Catalog #AAA6234154) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nkx 2.5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NKX2.5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Nkx 2.5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.