Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MUC7 Monoclonal Antibody | anti-MUC7 antibody

MUC7 (Mucin-7, MUC-7, Apo-MG2, Salivary Mucin-7, MG2, Mucin 7, DKFZp686J03256, FLJ27047, MGC34772) (MaxLight 750)

Gene Names
MUC7; MG2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MUC7; Monoclonal Antibody; MUC7 (Mucin-7; MUC-7; Apo-MG2; Salivary Mucin-7; MG2; Mucin 7; DKFZp686J03256; FLJ27047; MGC34772) (MaxLight 750); anti-MUC7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7F2
Specificity
Recognizes human MUC7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
377
Applicable Applications for anti-MUC7 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa36-135 from human MUC7 (NP_689504) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MUC7 antibody
MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
Product Categories/Family for anti-MUC7 antibody
References
1. Aberrant mucin glycoprotein patterns of chronic rhinosinusitis patients with bacterial biofilms. Tan L, Psaltis A, Baker LM, McGuckin M, Rousseau K, Wormald P.American Journal of Rhinology & Allergy (2010) DOI: 10.2500/ ajra.2010.24.3504

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mucin-7
NCBI Official Synonym Full Names
mucin 7, secreted
NCBI Official Symbol
MUC7
NCBI Official Synonym Symbols
MG2
NCBI Protein Information
mucin-7
UniProt Protein Name
Mucin-7
Protein Family
UniProt Gene Name
MUC7
UniProt Synonym Gene Names
MG2; MUC-7
UniProt Entry Name
MUC7_HUMAN

NCBI Description

This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. This antimicrobial protein has antibacterial and antifungal activity. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

MUC7: May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili. Genetic variations in MUC7 are associated with susceptibility to asthma (ASTHMA). The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: Golgi lumen

Molecular Function: protein binding

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; post-translational protein modification

Disease: Asthma, Susceptibility To

Research Articles on MUC7

Similar Products

Product Notes

The MUC7 muc7 (Catalog #AAA6233991) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MUC7 (Mucin-7, MUC-7, Apo-MG2, Salivary Mucin-7, MG2, Mucin 7, DKFZp686J03256, FLJ27047, MGC34772) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MUC7 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MUC7 muc7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MUC7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.