Mouse anti-Human MUC7 Monoclonal Antibody | anti-MUC7 antibody

MUC7 (Mucin-7, MUC-7, Apo-MG2, Salivary Mucin-7, MG2, Mucin 7, DKFZp686J03256, FLJ27047, MGC34772) (HRP)

Cat. Num. AAA6153640

• Gene Names: MUC7; MG2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MUC7; Monoclonal Antibody; MUC7 (Mucin-7; MUC-7; Apo-MG2; Salivary Mucin-7; MG2; Mucin 7; DKFZp686J03256; FLJ27047; MGC34772) (HRP); anti-MUC7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 7F2
• Specificity: Recognizes human MUC7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 377

• Applicable Applications for anti-MUC7 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa36-135 from human MUC7 (NP_689504) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD) usingMBS6010421.)

Testing Data

(Detection limit for recombinant GST tagged MUC7 is ~0.03ng/ml usingMBS6010421.)

Related Product Information for anti-MUC7 antibody

May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili.

Product Categories/Family for anti-MUC7 antibody

Antibodies; Mucin

References

1. Aberrant mucin glycoprotein patterns of chronic rhinosinusitis patients with bacterial biofilms. Tan L, Psaltis A, Baker LM, McGuckin M, Rousseau K, Wormald P.American Journal of Rhinology & Allergy (2010) DOI: 10.2500/ ajra.2010.24.3504

NCBI and Uniprot Product Information

• NCBI GI #: 222418645
• NCBI GeneID: 4589
• NCBI Accession #: NP_689504
• NCBI GenBank Nucleotide #: NM_152291
• UniProt Accession #: Q8TAX7
• NCBI Official Full Name: mucin-7
• NCBI Official Synonym Full Names: mucin 7, secreted
• NCBI Official Symbol: MUC7
• NCBI Official Synonym Symbols: MG2
• NCBI Protein Information: mucin-7
• UniProt Protein Name: Mucin-7
• Protein Family: Mucin
• UniProt Gene Name: MUC7
• UniProt Synonym Gene Names: MG2; MUC-7
• UniProt Entry Name: MUC7_HUMAN

NCBI Description

This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. This antimicrobial protein has antibacterial and antifungal activity. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

MUC7: May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili. Genetic variations in MUC7 are associated with susceptibility to asthma (ASTHMA). The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: Golgi lumen

Molecular Function: protein binding

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; post-translational protein modification

Disease: Asthma, Susceptibility To