Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TRPA1 Monoclonal Antibody | anti-TRPA1 antibody

TRPA1 (Transient Receptor Potential Cation Channel Subfamily A Member 1, Ankyrin-like with Transmembrane Domains Protein 1, ANKTM1, FEPS, Transformation-sensitive Protein p120) (MaxLight 650)

Gene Names
TRPA1; FEPS; FEPS1; ANKTM1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRPA1; Monoclonal Antibody; TRPA1 (Transient Receptor Potential Cation Channel Subfamily A Member 1; Ankyrin-like with Transmembrane Domains Protein 1; ANKTM1; FEPS; Transformation-sensitive Protein p120) (MaxLight 650); anti-TRPA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6G8
Specificity
Recognizes human TRPA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
5191
Applicable Applications for anti-TRPA1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1033-1118 from TRPA1 (NP_015628) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TRPA1 antibody
MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Product Categories/Family for anti-TRPA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens transient receptor potential cation channel subfamily A member 1 (TRPA1), mRNA
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily A member 1
NCBI Official Symbol
TRPA1
NCBI Official Synonym Symbols
FEPS; FEPS1; ANKTM1
NCBI Protein Information
transient receptor potential cation channel subfamily A member 1
UniProt Protein Name
Transient receptor potential cation channel subfamily A member 1
UniProt Gene Name
TRPA1
UniProt Synonym Gene Names
ANKTM1
UniProt Entry Name
TRPA1_HUMAN

NCBI Description

The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq, Jul 2008]

Uniprot Description

TRPA1: Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)- tetrahydrocannabinol (THC), the psychoactive component of marijuana. Not involved in menthol sensation. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system. Belongs to the transient receptor (TC 1.A.4) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q13

Cellular Component: stereocilium bundle; integral to plasma membrane; plasma membrane

Molecular Function: channel activity; calcium channel activity

Biological Process: response to drug; detection of mechanical stimulus involved in sensory perception of pain; detection of chemical stimulus involved in sensory perception of pain; response to hydrogen peroxide; response to pain; ion transport; thermoception; response to cold; transmembrane transport

Disease: Episodic Pain Syndrome, Familial, 1

Research Articles on TRPA1

Similar Products

Product Notes

The TRPA1 trpa1 (Catalog #AAA6225227) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRPA1 (Transient Receptor Potential Cation Channel Subfamily A Member 1, Ankyrin-like with Transmembrane Domains Protein 1, ANKTM1, FEPS, Transformation-sensitive Protein p120) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRPA1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRPA1 trpa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRPA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.