Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is ~0.3ng/ml using MBS648970 as a capture antibody.)

Mouse Cystinosin Monoclonal Antibody | anti-CTNS antibody

Cystinosin (CTNS) (MaxLight 650)

Gene Names
CTNS; PQLC4; SLC66A4; CTNS-LSB
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cystinosin; Monoclonal Antibody; Cystinosin (CTNS) (MaxLight 650); anti-CTNS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5G6
Specificity
Recognizes human Cystinosin. Species Crossreactivity: mouse, rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
367
Applicable Applications for anti-CTNS antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 of human Cystinosin with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit is ~0.3ng/ml using MBS648970 as a capture antibody.)

Testing Data (Detection limit is ~0.3ng/ml using MBS648970 as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CTNS expression in human liver usingMBS648970.)

Western Blot (WB) (Western Blot analysis of CTNS expression in human liver usingMBS648970.)

Western Blot (WB)

(Western Blot analysis of CTNS expression in Raw 264.7 usingMBS648970.)

Western Blot (WB) (Western Blot analysis of CTNS expression in Raw 264.7 usingMBS648970.)

Western Blot (WB)

(Western Blot analysis of CTNS expression in PC-12 usingMBS648970.)

Western Blot (WB) (Western Blot analysis of CTNS expression in PC-12 usingMBS648970.)
Related Product Information for anti-CTNS antibody
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CTNS antibody
References
1. Modulation of CTNS Gene Expression By Intracellular Thiols. Bellomo F, Corallini S, Pastore A, Palma A, Laurenzi C, Emma F, Taranta A.Free Radic Biol Med. 2010 Jan 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cystinosin isoform 2
NCBI Official Synonym Full Names
cystinosin, lysosomal cystine transporter
NCBI Official Symbol
CTNS
NCBI Official Synonym Symbols
PQLC4; SLC66A4; CTNS-LSB
NCBI Protein Information
cystinosin
UniProt Protein Name
Cystinosin
Protein Family
UniProt Gene Name
CTNS
UniProt Entry Name
CTNS_HUMAN

NCBI Description

This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]

Uniprot Description

CTNS: Thought to transport cystine out of lysosomes. Defects in CTNS are the cause of cystinosis nephropathic type (CTNS). It is a form of cystinosis, a lysosomal storage disease due to defective transport of cystine across the lysosomal membrane. This results in cystine accumulation and crystallization in the cells causing widespread tissue damage. The classical nephropathic form has onset in the first year of life and is characterized by a polyuro-polydipsic syndrome, marked height-weight growth delay, generalized impaired proximal tubular reabsorptive capacity, with severe fluid-electrolyte balance alterations, renal failure, ocular symptoms and other systemic complications. Defects in CTNS are the cause of cystinosis adult non- nephropathic type (CTNSANN). It is a form of cystinosis, a lysosomal storage disease due to defective transport of cystine across the lysosomal membrane. This results in cystine accumulation and crystallization in the cells causing widespread tissue damage. Cystinosis adult non-nephropathic type is characterized by ocular features and a benigne course. Patients manifest mild photophobia due to conjunctival and corneal cystine crystals. Defects in CTNS are the cause of cystinosis late-onset juvenile or adolescent nephropathic type (CTNSJAN). It is a form of cystinosis, a lysosomal storage disease due to defective transport of cystine across the lysosomal membrane. This results in cystine accumulation and crystallization in the cells causing widespread tissue damage. Late-onset juvenile or adolescent nephropathic cystinosis manifests itself first at age 10 to 12 years with proteinuria due to glomerular damage rather than with the manifestations of tubular damage that occur first in infantile cystinosis. There is no excess amino aciduria and stature is normal. Photophobia, late development of pigmentary retinopathy, and chronic headaches are features. Belongs to the cystinosin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: intermediate filament cytoskeleton; intracellular membrane-bound organelle; lysosomal membrane; lysosome; early endosome; late endosome; melanosome; integral to membrane; plasma membrane

Molecular Function: L-cystine transmembrane transporter activity

Biological Process: amino acid metabolic process; grooming behavior; ATP metabolic process; lens development in camera-type eye; melanin biosynthetic process; glutathione metabolic process; long-term memory; L-cystine transport; visual learning; brain development; cognition; adult walking behavior

Disease: Cystinosis, Adult Nonnephropathic; Cystinosis, Late-onset Juvenile Or Adolescent Nephropathic Type; Cystinosis, Nephropathic

Research Articles on CTNS

Similar Products

Product Notes

The CTNS ctns (Catalog #AAA6221736) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cystinosin (CTNS) (MaxLight 650) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cystinosin can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTNS ctns for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cystinosin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.