Mouse Cystinosin Monoclonal Antibody | anti-Ctns antibody

Cystinosin (CTNS)

Cat. Num. AAA648970

• Gene Names: Ctns; AI195360; AW049661
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: Cystinosin; Monoclonal Antibody; Cystinosin (CTNS); Anti -Cystinosin (CTNS); anti-Ctns antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5G6
• Specificity: Recognizes human CTNS. Species Crossreactivity: mouse and rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY

• Applicable Applications for anti-Ctns antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-100 from human CTNS (NP_004928) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is ~0.3ng/ml using MBS648970 as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CTNS expression in human liver using MBS648970.)

Western Blot (WB)

(Western Blot analysis of CTNS expression in HepG2 using MBS648970 .)

Western Blot (WB)

(Western Blot analysis of CTNS expression in Raw 264.7 using MBS648970.)

Western Blot (WB)

(Western Blot detection against immunogen using MBS648970 (36.74kD).)

Western Blot (WB)

(Western Blot analysis of CTNS expression in PC-12 using MBS648970.)

Related Product Information for anti-Ctns antibody

This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-Ctns antibody

Antibodies; Abs to Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13752577
• NCBI GeneID: 83429
• NCBI Accession #: NP_112541.1
• NCBI GenBank Nucleotide #: NM_031251.4
• UniProt Accession #: P57757
• Molecular Weight: 42,203 Da
• NCBI Official Full Name: cystinosin
• NCBI Official Synonym Full Names: cystinosis, nephropathic
• NCBI Official Symbol: Ctns
• NCBI Official Synonym Symbols: AI195360; AW049661
• NCBI Protein Information: cystinosin
• UniProt Protein Name: Cystinosin
• Protein Family: Cystinosin
• UniProt Gene Name: Ctns
• UniProt Entry Name: CTNS_MOUSE

Uniprot Description

Function: Thought to transport cystine out of lysosomes.

Subcellular location: Lysosome membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the cystinosin family.Contains 2 PQ-loop domains.