Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse DNAJB2 Monoclonal Antibody | anti-DNAJB2 antibody

DNAJB2 (DnaJ (Hsp40) Homolog, Subfamily B, Member 2, HSJ1, HSPF3) (MaxLight 550)

Gene Names
DNAJB2; HSJ1; CMT2T; DSMA5; HSJ-1; HSPF3
Applications
Western Blot
Purity
Purified
Synonyms
DNAJB2; Monoclonal Antibody; DNAJB2 (DnaJ (Hsp40) Homolog; Subfamily B; Member 2; HSJ1; HSPF3) (MaxLight 550); DnaJ (Hsp40) Homolog; HSPF3; anti-DNAJB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B7
Specificity
Recognizes DNAJB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-DNAJB2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DNAJB2 (NP_006727, 216aa-324aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DNAJB2 antibody
Mouse monoclonal antibody raised against a partial recombinant DNAJB2.
Product Categories/Family for anti-DNAJB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,569 Da
NCBI Official Full Name
dnaJ homolog subfamily B member 2 isoform b
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily B, member 2
NCBI Official Symbol
DNAJB2
NCBI Official Synonym Symbols
HSJ1; CMT2T; DSMA5; HSJ-1; HSPF3
NCBI Protein Information
dnaJ homolog subfamily B member 2
Protein Family

NCBI Description

This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011]

Research Articles on DNAJB2

Similar Products

Product Notes

The DNAJB2 (Catalog #AAA6216601) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DNAJB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DNAJB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNAJB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.