Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TAF1C Monoclonal Antibody | anti-TAF1C antibody

TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C, RNA Polymerase I-specific TBP-associated Factor 110kD, TAFI110, TATA Box-binding Protein-associated Factor 1C, TBP-associated Factor 1C, Transcription Initiation Factor SL1/TIF-

Gene Names
TAF1C; SL1; TAFI95; TAFI110; MGC:39976
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF1C; Monoclonal Antibody; TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C; RNA Polymerase I-specific TBP-associated Factor 110kD; TAFI110; TATA Box-binding Protein-associated Factor 1C; TBP-associated Factor 1C; Transcription Initiation Factor SL1/TIF-; anti-TAF1C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E6
Specificity
Recognizes human TAF1C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TAF1C antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa761-870 from TAF1C (NP_005670) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TAF1C antibody
Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3.
Product Categories/Family for anti-TAF1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
TATA box-binding protein-associated factor RNA polymerase I subunit C isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein associated factor, RNA polymerase I subunit C
NCBI Official Symbol
TAF1C
NCBI Official Synonym Symbols
SL1; TAFI95; TAFI110; MGC:39976
NCBI Protein Information
TATA box-binding protein-associated factor RNA polymerase I subunit C
UniProt Protein Name
TATA box-binding protein-associated factor RNA polymerase I subunit C
UniProt Gene Name
TAF1C
UniProt Synonym Gene Names
TAFI110
UniProt Entry Name
TAF1C_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2011]

Uniprot Description

Function: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3. Ref.8 Ref.9

Subunit structure: Component of the transcription factor SL1/TIF-IB complex, composed of TBP and at least TAF1A, TAF1B, TAF1C and TAF1D. In the complex interacts directly with TBP, TAF1A and TAF1B. Interaction of the SL1/TIF-IB subunits with TBP excludes interaction of TBP with the transcription factor IID (TFIID) subunits. Interacts with MYC and RRN3. Interacts with p53/TP53; the interaction prevents the association of SL1/TIF-IB with UBTF and represses RNA polymerase I transcription. Ref.1 Ref.7 Ref.8 Ref.10

Subcellular location: Nucleus.

Sequence caution: The sequence BAD92831.1 differs from that shown. Reason: Probable cloning artifact.

Research Articles on TAF1C

Similar Products

Product Notes

The TAF1C taf1c (Catalog #AAA6214321) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C, RNA Polymerase I-specific TBP-associated Factor 110kD, TAFI110, TATA Box-binding Protein-associated Factor 1C, TBP-associated Factor 1C, Transcription Initiation Factor SL1/TIF- reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1C can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF1C taf1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF1C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.