Mouse anti-Human TAF1C Monoclonal Antibody | anti-TAF1C antibody

TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C, RNA Polymerase I-specific TBP-associated Factor 110kD, TAFI110, TATA Box-binding Protein-associated Factor 1C, TBP-associated Factor 1C, Transcription Initiation Factor SL1/TIF-

Cat. Num. AAA6139410

• Gene Names: TAF1C; SL1; TAFI95; TAFI110; MGC:39976
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF1C; Monoclonal Antibody; TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C; RNA Polymerase I-specific TBP-associated Factor 110kD; TAFI110; TATA Box-binding Protein-associated Factor 1C; TBP-associated Factor 1C; Transcription Initiation Factor SL1/TIF-; anti-TAF1C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E6
• Specificity: Recognizes human TAF1C.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TAF1C antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa761-870 from TAF1C (NP_005670) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF1C expression in transfected 293T cell line by TAF1C monoclonal antibody. Lane 1: TAF1C transfected lysate (85.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TAF1C is 1ng/ml as a capture antibody.)

Related Product Information for anti-TAF1C antibody

Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3.

Product Categories/Family for anti-TAF1C antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 341926253
• NCBI GeneID: 9013
• NCBI Accession #: NP_005670
• NCBI GenBank Nucleotide #: NM_005679
• UniProt Accession #: Q15572
• Molecular Weight: 95kDa
• NCBI Official Full Name: TATA box-binding protein-associated factor RNA polymerase I subunit C isoform 1
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor, RNA polymerase I subunit C
• NCBI Official Symbol: TAF1C
• NCBI Official Synonym Symbols: SL1; TAFI95; TAFI110; MGC:39976
• NCBI Protein Information: TATA box-binding protein-associated factor RNA polymerase I subunit C
• UniProt Protein Name: TATA box-binding protein-associated factor RNA polymerase I subunit C
• Protein Family: TATA box-binding protein-associated factor
• UniProt Gene Name: TAF1C
• UniProt Synonym Gene Names: TAFI110
• UniProt Entry Name: TAF1C_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2011]

Uniprot Description

Function: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3. Ref.8 Ref.9

Subunit structure: Component of the transcription factor SL1/TIF-IB complex, composed of TBP and at least TAF1A, TAF1B, TAF1C and TAF1D. In the complex interacts directly with TBP, TAF1A and TAF1B. Interaction of the SL1/TIF-IB subunits with TBP excludes interaction of TBP with the transcription factor IID (TFIID) subunits. Interacts with MYC and RRN3. Interacts with p53/TP53; the interaction prevents the association of SL1/TIF-IB with UBTF and represses RNA polymerase I transcription. Ref.1 Ref.7 Ref.8 Ref.10

Subcellular location: Nucleus.

Sequence caution: The sequence BAD92831.1 differs from that shown. Reason: Probable cloning artifact.