Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat SCN9A Monoclonal Antibody | anti-SCN9A antibody

SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) (MaxLight 550)

Gene Names
SCN9A; PN1; ETHA; NENA; SFNP; FEB3B; NE-NA; GEFSP7; HSAN2D; Nav1.7
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCN9A; Monoclonal Antibody; SCN9A (Sodium Channel Protein Type 9 Subunit alpha; Neuroendocrine Sodium Channel; hNE-Na; Peripheral Sodium Channel 1; PN1; Sodium Channel Protein Type IX Subunit alpha; Voltage-gated Sodium Channel Subunit alpha Nav1.7; NENA) (MaxLight 550); anti-SCN9A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5A11
Specificity
Recognizes human SCN9A. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
1977
Applicable Applications for anti-SCN9A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa269-340 from human SCN9A (NP_002968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SCN9A antibody
Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na+ channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain.
Product Categories/Family for anti-SCN9A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
sodium channel protein type 9 subunit alpha isoform 1
NCBI Official Synonym Full Names
sodium voltage-gated channel alpha subunit 9
NCBI Official Symbol
SCN9A
NCBI Official Synonym Symbols
PN1; ETHA; NENA; SFNP; FEB3B; NE-NA; GEFSP7; HSAN2D; Nav1.7
NCBI Protein Information
sodium channel protein type 9 subunit alpha
UniProt Protein Name
Sodium channel protein type 9 subunit alpha
Protein Family
UniProt Gene Name
SCN9A
UniProt Synonym Gene Names
NENA; hNE-Na; PN1
UniProt Entry Name
SCN9A_HUMAN

NCBI Description

This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq, Aug 2009]

Uniprot Description

SCN9A: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain. Defects in SCN9A are the cause of primary erythermalgia (PERYTHM). It is an autosomal dominant disease characterized by recurrent episodes of severe pain associated with redness and warmth in the feet or hands. Defects in SCN9A are the cause of congenital indifference to pain autosomal recessive (CIPAR); also known as channelopathy-associated insensitivity to pain. A disorder characterized by congenital inability to perceive any form of pain, in any part of the body. All other sensory modalities are preserved and the peripheral and central nervous systems are apparently intact. Patients perceive the sensations of touch, warm and cold temperature, proprioception, tickle and pressure, but not painful stimuli. There is no evidence of a motor or sensory neuropathy, either axonal or demyelinating. Defects in SCN9A are a cause of paroxysmal extreme pain disorder (PEPD); previously known as familial rectal pain (FRP). PEPD is an autosomal dominant paroxysmal disorder of pain and autonomic dysfunction. The distinctive features are paroxysmal episodes of burning pain in the rectal, ocular, and mandibular areas accompanied by autonomic manifestations such as skin flushing. Defects in SCN9A are a cause of generalized epilepsy with febrile seizures plus type 7 (GEFS+7). GEFS+7 is a rare autosomal dominant, familial condition with incomplete penetrance and large intrafamilial variability. Patients display febrile seizures persisting sometimes beyond the age of 6 years and/or a variety of afebrile seizure types. This disease combines febrile seizures, generalized seizures often precipitated by fever at age 6 years or more, and partial seizures, with a variable degree of severity. Defects in SCN9A are the cause of familial febrile convulsions type 3B (FEB3B). FEB3B consists of seizures associated with febrile episodes in childhood without any evidence of intracranial infection or defined pathologic or traumatic cause. It is a common condition, affecting 2-5% of children aged 3 months to 5 years. The majority are simple febrile seizures (generally defined as generalized onset, single seizures with a duration of less than 30 minutes). Complex febrile seizures are characterized by focal onset, duration greater than 30 minutes, and/or more than one seizure in a 24 hour period. The likelihood of developing epilepsy following simple febrile seizures is low. Complex febrile seizures are associated with a moderately increased incidence of epilepsy. Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.7/SCN9A subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, sodium; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: voltage-gated sodium channel complex; plasma membrane

Molecular Function: sodium ion binding; voltage-gated sodium channel activity

Biological Process: behavioral response to pain; response to toxin; sodium ion transport; generation of action potential; inflammatory response; post-embryonic development

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type Iia; Generalized Epilepsy With Febrile Seizures Plus, Type 7; Erythermalgia, Primary; Paroxysmal Extreme Pain Disorder; Epileptic Encephalopathy, Early Infantile, 6; Indifference To Pain, Congenital, Autosomal Recessive

Research Articles on SCN9A

Similar Products

Product Notes

The SCN9A scn9a (Catalog #AAA6213847) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) (MaxLight 550) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCN9A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCN9A scn9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCN9A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.