Mouse anti-Human, Rat SCN9A Monoclonal Antibody | anti-SCN9A antibody

SCN9A (Sodium Channel Protein Type 9 Subunit alpha, Neuroendocrine Sodium Channel, hNE-Na, Peripheral Sodium Channel 1, PN1, Sodium Channel Protein Type IX Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.7, NENA) (Biotin)

Cat. Num. AAA6144239

• Gene Names: SCN9A; PN1; ETHA; NENA; SFNP; FEB3B; NE-NA; GEFSP7; HSAN2D; Nav1.7
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SCN9A; Monoclonal Antibody; SCN9A (Sodium Channel Protein Type 9 Subunit alpha; Neuroendocrine Sodium Channel; hNE-Na; Peripheral Sodium Channel 1; PN1; Sodium Channel Protein Type IX Subunit alpha; Voltage-gated Sodium Channel Subunit alpha Nav1.7; NENA) (Biotin); anti-SCN9A antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5A11
• Specificity: Recognizes human SCN9A. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1977

• Applicable Applications for anti-SCN9A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa269-340 from human SCN9A (NP_002968) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB)

(SCN9A monoclonal antibody. Western Blot analysis of SCN9A expression in rat testis.)

Related Product Information for anti-SCN9A antibody

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na+ channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain.

Product Categories/Family for anti-SCN9A antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 4506813
• NCBI GeneID: 6335
• NCBI Accession #: NP_002968
• NCBI GenBank Nucleotide #: NM_002977
• UniProt Accession #: Q15858
• NCBI Official Full Name: sodium channel protein type 9 subunit alpha isoform 1
• NCBI Official Synonym Full Names: sodium voltage-gated channel alpha subunit 9
• NCBI Official Symbol: SCN9A
• NCBI Official Synonym Symbols: PN1; ETHA; NENA; SFNP; FEB3B; NE-NA; GEFSP7; HSAN2D; Nav1.7
• NCBI Protein Information: sodium channel protein type 9 subunit alpha
• UniProt Protein Name: Sodium channel protein type 9 subunit alpha
• Protein Family: Sodium channel protein
• UniProt Gene Name: SCN9A
• UniProt Synonym Gene Names: NENA; hNE-Na; PN1
• UniProt Entry Name: SCN9A_HUMAN

NCBI Description

This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq, Aug 2009]

Uniprot Description

SCN9A: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain. Defects in SCN9A are the cause of primary erythermalgia (PERYTHM). It is an autosomal dominant disease characterized by recurrent episodes of severe pain associated with redness and warmth in the feet or hands. Defects in SCN9A are the cause of congenital indifference to pain autosomal recessive (CIPAR); also known as channelopathy-associated insensitivity to pain. A disorder characterized by congenital inability to perceive any form of pain, in any part of the body. All other sensory modalities are preserved and the peripheral and central nervous systems are apparently intact. Patients perceive the sensations of touch, warm and cold temperature, proprioception, tickle and pressure, but not painful stimuli. There is no evidence of a motor or sensory neuropathy, either axonal or demyelinating. Defects in SCN9A are a cause of paroxysmal extreme pain disorder (PEPD); previously known as familial rectal pain (FRP). PEPD is an autosomal dominant paroxysmal disorder of pain and autonomic dysfunction. The distinctive features are paroxysmal episodes of burning pain in the rectal, ocular, and mandibular areas accompanied by autonomic manifestations such as skin flushing. Defects in SCN9A are a cause of generalized epilepsy with febrile seizures plus type 7 (GEFS+7). GEFS+7 is a rare autosomal dominant, familial condition with incomplete penetrance and large intrafamilial variability. Patients display febrile seizures persisting sometimes beyond the age of 6 years and/or a variety of afebrile seizure types. This disease combines febrile seizures, generalized seizures often precipitated by fever at age 6 years or more, and partial seizures, with a variable degree of severity. Defects in SCN9A are the cause of familial febrile convulsions type 3B (FEB3B). FEB3B consists of seizures associated with febrile episodes in childhood without any evidence of intracranial infection or defined pathologic or traumatic cause. It is a common condition, affecting 2-5% of children aged 3 months to 5 years. The majority are simple febrile seizures (generally defined as generalized onset, single seizures with a duration of less than 30 minutes). Complex febrile seizures are characterized by focal onset, duration greater than 30 minutes, and/or more than one seizure in a 24 hour period. The likelihood of developing epilepsy following simple febrile seizures is low. Complex febrile seizures are associated with a moderately increased incidence of epilepsy. Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.7/SCN9A subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, sodium; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: voltage-gated sodium channel complex; plasma membrane

Molecular Function: sodium ion binding; voltage-gated sodium channel activity

Biological Process: behavioral response to pain; response to toxin; sodium ion transport; generation of action potential; inflammatory response; post-embryonic development

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type Iia; Generalized Epilepsy With Febrile Seizures Plus, Type 7; Erythermalgia, Primary; Paroxysmal Extreme Pain Disorder; Epileptic Encephalopathy, Early Infantile, 6; Indifference To Pain, Congenital, Autosomal Recessive