Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PAPPA Monoclonal Antibody | anti-PAPPA antibody

PAPPA (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Pregnancy-associated Plasma Protein A, PAPP-A) (MaxLight 550)

Gene Names
PAPPA; PAPA; DIPLA1; PAPP-A; PAPPA1; ASBABP2; IGFBP-4ase
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAPPA; Monoclonal Antibody; PAPPA (Pappalysin-1; Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease; IGF-dependent IGFBP-4 Protease; IGFBP-4ase; Pregnancy-associated Plasma Protein A; PAPP-A) (MaxLight 550); anti-PAPPA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G3
Specificity
Recognizes human PAPPA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-PAPPA antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa85-195 from human PAPPA (NP_002572) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PAPPA antibody
PAPP A (PAPP-A, Insulin-like growth factor binding protein-4 protease, PAPP-A-proMBP complex) was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500kD, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Low maternal serum levels of PAPP-A in first trimester biochemical screening is used as a marker of Down's syndrome (Trisomy 21).
Product Categories/Family for anti-PAPPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Pappalysin-1
NCBI Official Synonym Full Names
pregnancy-associated plasma protein A, pappalysin 1
NCBI Official Symbol
PAPPA
NCBI Official Synonym Symbols
PAPA; DIPLA1; PAPP-A; PAPPA1; ASBABP2; IGFBP-4ase
NCBI Protein Information
pappalysin-1; IGF-dependent IGFBP-4 protease; aspecific BCL2 ARE-binding protein 2; differentially placenta 1 expressed protein; insulin-like growth factor-dependent IGF binding protein-4 protease; insulin-like growth factor-dependent IGF-binding protein
Protein Family

NCBI Description

This gene encodes a secreted metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. [provided by RefSeq, Jul 2008]

Research Articles on PAPPA

Similar Products

Product Notes

The PAPPA (Catalog #AAA6212972) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAPPA (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Pregnancy-associated Plasma Protein A, PAPP-A) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAPPA can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAPPA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAPPA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.