Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NFE2L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Rabbit NFE2L1 Polyclonal Antibody | anti-NFE2L1 antibody

NFE2L1 Antibody - middle region

Gene Names
NFE2L1; NRF1; TCF11; LCR-F1
Reactivity
Cow, Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NFE2L1; Polyclonal Antibody; NFE2L1 Antibody - middle region; anti-NFE2L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP
Sequence Length
772
Applicable Applications for anti-NFE2L1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NFE2L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NFE2L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NFE2L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(NFE2L1 (nuclear factor (erythroid-derived 2)-like 1) Antibody (against the middle region of NFE2L1) (50ug) validated by WB using Jurkat cell lysate at 0.2-1 ug/ml.)

Western Blot (WB) (NFE2L1 (nuclear factor (erythroid-derived 2)-like 1) Antibody (against the middle region of NFE2L1) (50ug) validated by WB using Jurkat cell lysate at 0.2-1 ug/ml.)
Related Product Information for anti-NFE2L1 antibody
This is a rabbit polyclonal antibody against NFE2L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFE2L1 activates erythroid-specific, globin gene expression. This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 DB097304.1 1-256 257-603 DA230932.1 224-570 604-1464 AK090459.1 569-1429 1465-3372 U08853.1 199-2106 3373-4349 AC004477.2 104176-105152 4350-4891 BM983473.1 1-542 c

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
endoplasmic reticulum membrane sensor NFE2L1 isoform 1
NCBI Official Synonym Full Names
nuclear factor, erythroid 2 like 1
NCBI Official Symbol
NFE2L1
NCBI Official Synonym Symbols
NRF1; TCF11; LCR-F1
NCBI Protein Information
endoplasmic reticulum membrane sensor NFE2L1
UniProt Protein Name
Nuclear factor erythroid 2-related factor 1
UniProt Gene Name
NFE2L1
UniProt Synonym Gene Names
HBZ17; NRF1; TCF11; NF-E2-related factor 1; NFE2-related factor 1; TCF-11
UniProt Entry Name
NF2L1_HUMAN

NCBI Description

This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for "nuclear respiratory factor 1" which has an official symbol of NRF1. [provided by RefSeq, Jul 2008]

Uniprot Description

NFE2L1: Activates erythroid-specific, globin gene expression. Interacts with KEAP1. Belongs to the bZIP family. CNC subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane; nucleus

Molecular Function: transcription cofactor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; anatomical structure morphogenesis; erythrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; inflammatory response; heme biosynthetic process

Research Articles on NFE2L1

Similar Products

Product Notes

The NFE2L1 nfe2l1 (Catalog #AAA3224593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFE2L1 Antibody - middle region reacts with Cow, Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFE2L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFE2L1 nfe2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HTYNMAPSAL DSADLPPPSA LKKGSKEKQA DFLDKQMSRD EHRARAMKIP. It is sometimes possible for the material contained within the vial of "NFE2L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.