Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GPR182 Monoclonal Antibody | anti-GPR182 antibody

GPR182 (G-Protein Coupled Receptor 182, 7TMR, Adrenomedullin Receptor L1, ADMR, AMR, AM-R, G10D, Gamrh, hrhAMR, MGC34399) (MaxLight 550)

Gene Names
GPR182; AMR; 7TMR; ADMR; AM-R; G10D; L1-R; gamrh; hrhAMR
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GPR182; Monoclonal Antibody; GPR182 (G-Protein Coupled Receptor 182; 7TMR; Adrenomedullin Receptor L1; ADMR; AMR; AM-R; G10D; Gamrh; hrhAMR; MGC34399) (MaxLight 550); anti-GPR182 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B10
Specificity
Recognizes human GPR182.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
404
Applicable Applications for anti-GPR182 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-55 from GPR182 (NP_009195) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GPR182 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-GPR182 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
G-protein coupled receptor 182
NCBI Official Synonym Full Names
G protein-coupled receptor 182
NCBI Official Symbol
GPR182
NCBI Official Synonym Symbols
AMR; 7TMR; ADMR; AM-R; G10D; L1-R; gamrh; hrhAMR
NCBI Protein Information
G-protein coupled receptor 182
UniProt Protein Name
G-protein coupled receptor 182
UniProt Gene Name
GPR182
UniProt Synonym Gene Names
ADMR
UniProt Entry Name
GP182_HUMAN

NCBI Description

Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq, Jul 2008]

Uniprot Description

GPR182: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; transmembrane receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; cell surface receptor linked signal transduction

Research Articles on GPR182

Similar Products

Product Notes

The GPR182 gpr182 (Catalog #AAA6211750) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GPR182 (G-Protein Coupled Receptor 182, 7TMR, Adrenomedullin Receptor L1, ADMR, AMR, AM-R, G10D, Gamrh, hrhAMR, MGC34399) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR182 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPR182 gpr182 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR182, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.